SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386008901|ref|YP_005927179.1| from Listeria monocytogenes L99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386008901|ref|YP_005927179.1|
Domain Number 1 Region: 39-410
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.5e-83
Family Phosphate binding protein-like 0.00000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386008901|ref|YP_005927179.1|
Sequence length 419
Comment maltose/maltodextrin ABC transporter maltose/maltodextrin-binding protein [Listeria monocytogenes L99]
Sequence
MKRFKKVGIVSAVLVMALSLAACGGGKDTSKSGSSDEKTLTVSVDAGYKDYVNKIKGDFE
KDNDVKVKVVEKDMFETLEALPLDGPAGTAPDVMMSAFDRIGSLGQQGHLAEVKLGNKDD
YDEKDQKQVTIDDKIYGAPAIIETLVLYYNKDLLDKAPATFKDLETLSKDSRFAFTSEKG
KNTGFLAKWTDFYFSYGLLAGYGGYVFGDEGTNPKDIGLNNKGSVEGITYATKWFQDVWP
KGMQDNKSADDFIQDQFVKGKAAAILGGPWSAANYKEAKINYGVAKIPTLNNGKEYSPFA
GGKGWVVSNYSKNKDVAQKWLDYVTNQKNQETLYDMTNEVPANLKARDTAKSKNDELTNA
VIEQYKNAQPMPNIPEMSEVWTGAENLMFDAASGSKTPQQSADDAVKVIEDNVTQKYTK
Download sequence
Identical sequences A0A0E0UXS0 A0A0E1R7Q8 A0A0E1Y3B0 A0A0H3GM53 A0A241SRV7 A0A2G8Q631 A0A2G8QCB7 A0A2G8QFI6 A0A2G8QPY3 A0A2G8R1P7 H1G9B5 L8DVJ5 Q7ANX1 Q929P4
gi|470208029|ref|YP_007604604.1| gi|16804164|ref|NP_465649.1| gi|406704917|ref|YP_006755271.1| gi|470211167|ref|YP_007607741.1| gi|404414207|ref|YP_006699794.1| gi|386008901|ref|YP_005927179.1| gi|424715008|ref|YP_007015723.1| 169963.lmo2125 265669.LMOf2365_2159 272626.lin2230 552536.LMHCC_0421 634178.Lm4b_02149 gi|405756301|ref|YP_006679765.1| gi|226224732|ref|YP_002758839.1| gi|386732871|ref|YP_006206367.1| gi|386054380|ref|YP_005971938.1| gi|217963714|ref|YP_002349392.1| gi|405750483|ref|YP_006673949.1| gi|16801295|ref|NP_471563.1| gi|404411429|ref|YP_006697017.1| gi|46908361|ref|YP_014750.1| IDP05761 NP_465649.1.42710 WP_003724548.1.100060 WP_003724548.1.100078 WP_003724548.1.100112 WP_003724548.1.100142 WP_003724548.1.100160 WP_003724548.1.100221 WP_003724548.1.100229 WP_003724548.1.100261 WP_003724548.1.10039 WP_003724548.1.100458 WP_003724548.1.100510 WP_003724548.1.100522 WP_003724548.1.100530 WP_003724548.1.100651 WP_003724548.1.100835 WP_003724548.1.10112 WP_003724548.1.101144 WP_003724548.1.101184 WP_003724548.1.101252 WP_003724548.1.101318 WP_003724548.1.101354 WP_003724548.1.101368 WP_003724548.1.101527 WP_003724548.1.101529 WP_003724548.1.101688 WP_003724548.1.101752 WP_003724548.1.10176 WP_003724548.1.101772 WP_003724548.1.101811 WP_003724548.1.10182 WP_003724548.1.10186 WP_003724548.1.101945 WP_003724548.1.10198 WP_003724548.1.10210 WP_003724548.1.102145 WP_003724548.1.102150 WP_003724548.1.10418 WP_003724548.1.10420 WP_003724548.1.10444 WP_003724548.1.10460 WP_003724548.1.10484 WP_003724548.1.11086 WP_003724548.1.11177 WP_003724548.1.1123 WP_003724548.1.11266 WP_003724548.1.11313 WP_003724548.1.11326 WP_003724548.1.11419 WP_003724548.1.1146 WP_003724548.1.1160 WP_003724548.1.11633 WP_003724548.1.11686 WP_003724548.1.11689 WP_003724548.1.11712 WP_003724548.1.11738 WP_003724548.1.11779 WP_003724548.1.11788 WP_003724548.1.11851 WP_003724548.1.11940 WP_003724548.1.11973 WP_003724548.1.11976 WP_003724548.1.12020 WP_003724548.1.12028 WP_003724548.1.12142 WP_003724548.1.12143 WP_003724548.1.12148 WP_003724548.1.12278 WP_003724548.1.12287 WP_003724548.1.12377 WP_003724548.1.12417 WP_003724548.1.12544 WP_003724548.1.12634 WP_003724548.1.12824 WP_003724548.1.12988 WP_003724548.1.12993 WP_003724548.1.13004 WP_003724548.1.13052 WP_003724548.1.13105 WP_003724548.1.13134 WP_003724548.1.13160 WP_003724548.1.13180 WP_003724548.1.13234 WP_003724548.1.13304 WP_003724548.1.13329 WP_003724548.1.13360 WP_003724548.1.13428 WP_003724548.1.13684 WP_003724548.1.13695 WP_003724548.1.137 WP_003724548.1.13779 WP_003724548.1.13833 WP_003724548.1.13847 WP_003724548.1.13855 WP_003724548.1.14072 WP_003724548.1.14103 WP_003724548.1.14339 WP_003724548.1.14636 WP_003724548.1.14641 WP_003724548.1.14832 WP_003724548.1.14875 WP_003724548.1.14895 WP_003724548.1.15085 WP_003724548.1.15122 WP_003724548.1.15340 WP_003724548.1.15342 WP_003724548.1.15495 WP_003724548.1.155 WP_003724548.1.15518 WP_003724548.1.1556 WP_003724548.1.15564 WP_003724548.1.15618 WP_003724548.1.15619 WP_003724548.1.15659 WP_003724548.1.1575 WP_003724548.1.1576 WP_003724548.1.15816 WP_003724548.1.15847 WP_003724548.1.16207 WP_003724548.1.16403 WP_003724548.1.16499 WP_003724548.1.16516 WP_003724548.1.1657 WP_003724548.1.16631 WP_003724548.1.1667 WP_003724548.1.16726 WP_003724548.1.16746 WP_003724548.1.1678 WP_003724548.1.1688 WP_003724548.1.17106 WP_003724548.1.17131 WP_003724548.1.17228 WP_003724548.1.17352 WP_003724548.1.17375 WP_003724548.1.17398 WP_003724548.1.17399 WP_003724548.1.1764 WP_003724548.1.17695 WP_003724548.1.17774 WP_003724548.1.178 WP_003724548.1.1794 WP_003724548.1.17947 WP_003724548.1.18026 WP_003724548.1.1803 WP_003724548.1.18222 WP_003724548.1.18289 WP_003724548.1.18463 WP_003724548.1.18576 WP_003724548.1.18648 WP_003724548.1.18677 WP_003724548.1.18689 WP_003724548.1.18721 WP_003724548.1.18833 WP_003724548.1.18979 WP_003724548.1.19080 WP_003724548.1.19112 WP_003724548.1.19167 WP_003724548.1.19189 WP_003724548.1.19195 WP_003724548.1.19246 WP_003724548.1.1929 WP_003724548.1.19372 WP_003724548.1.19409 WP_003724548.1.19443 WP_003724548.1.19452 WP_003724548.1.1947 WP_003724548.1.19472 WP_003724548.1.19542 WP_003724548.1.19548 WP_003724548.1.19549 WP_003724548.1.19584 WP_003724548.1.19607 WP_003724548.1.19615 WP_003724548.1.19626 WP_003724548.1.19685 WP_003724548.1.197 WP_003724548.1.19901 WP_003724548.1.20263 WP_003724548.1.20378 WP_003724548.1.20402 WP_003724548.1.20548 WP_003724548.1.20672 WP_003724548.1.21046 WP_003724548.1.21099 WP_003724548.1.21133 WP_003724548.1.21371 WP_003724548.1.21428 WP_003724548.1.21429 WP_003724548.1.21529 WP_003724548.1.21542 WP_003724548.1.21567 WP_003724548.1.21597 WP_003724548.1.21705 WP_003724548.1.21706 WP_003724548.1.21711 WP_003724548.1.21874 WP_003724548.1.21884 WP_003724548.1.21889 WP_003724548.1.21926 WP_003724548.1.21995 WP_003724548.1.22099 WP_003724548.1.22154 WP_003724548.1.22188 WP_003724548.1.22190 WP_003724548.1.22194 WP_003724548.1.22202 WP_003724548.1.22221 WP_003724548.1.22383 WP_003724548.1.22434 WP_003724548.1.22468 WP_003724548.1.22597 WP_003724548.1.22656 WP_003724548.1.22962 WP_003724548.1.23060 WP_003724548.1.23139 WP_003724548.1.23193 WP_003724548.1.23254 WP_003724548.1.23255 WP_003724548.1.23291 WP_003724548.1.233 WP_003724548.1.2340 WP_003724548.1.23419 WP_003724548.1.23425 WP_003724548.1.23433 WP_003724548.1.23448 WP_003724548.1.23582 WP_003724548.1.23650 WP_003724548.1.2368 WP_003724548.1.23781 WP_003724548.1.23828 WP_003724548.1.23848 WP_003724548.1.24048 WP_003724548.1.24075 WP_003724548.1.24115 WP_003724548.1.2422 WP_003724548.1.24335 WP_003724548.1.24349 WP_003724548.1.24370 WP_003724548.1.24411 WP_003724548.1.24422 WP_003724548.1.24531 WP_003724548.1.24546 WP_003724548.1.24600 WP_003724548.1.24667 WP_003724548.1.24818 WP_003724548.1.24847 WP_003724548.1.24867 WP_003724548.1.24934 WP_003724548.1.24972 WP_003724548.1.24975 WP_003724548.1.25020 WP_003724548.1.25057 WP_003724548.1.25300 WP_003724548.1.25401 WP_003724548.1.2545 WP_003724548.1.25456 WP_003724548.1.25471 WP_003724548.1.25500 WP_003724548.1.25616 WP_003724548.1.25746 WP_003724548.1.25788 WP_003724548.1.25805 WP_003724548.1.25896 WP_003724548.1.26052 WP_003724548.1.26060 WP_003724548.1.26138 WP_003724548.1.26139 WP_003724548.1.26145 WP_003724548.1.26146 WP_003724548.1.26166 WP_003724548.1.26170 WP_003724548.1.26322 WP_003724548.1.26350 WP_003724548.1.26406 WP_003724548.1.26523 WP_003724548.1.26632 WP_003724548.1.26634 WP_003724548.1.2666 WP_003724548.1.26891 WP_003724548.1.27056 WP_003724548.1.27132 WP_003724548.1.27143 WP_003724548.1.27200 WP_003724548.1.27281 WP_003724548.1.27517 WP_003724548.1.27669 WP_003724548.1.27681 WP_003724548.1.27728 WP_003724548.1.27839 WP_003724548.1.27860 WP_003724548.1.27891 WP_003724548.1.27948 WP_003724548.1.28042 WP_003724548.1.28060 WP_003724548.1.28062 WP_003724548.1.28076 WP_003724548.1.28098 WP_003724548.1.28123 WP_003724548.1.2824 WP_003724548.1.28260 WP_003724548.1.28297 WP_003724548.1.2832 WP_003724548.1.28325 WP_003724548.1.28369 WP_003724548.1.28402 WP_003724548.1.2855 WP_003724548.1.28722 WP_003724548.1.28747 WP_003724548.1.28792 WP_003724548.1.28803 WP_003724548.1.28804 WP_003724548.1.28818 WP_003724548.1.2920 WP_003724548.1.29309 WP_003724548.1.29550 WP_003724548.1.29558 WP_003724548.1.29562 WP_003724548.1.29565 WP_003724548.1.29569 WP_003724548.1.29634 WP_003724548.1.29705 WP_003724548.1.29723 WP_003724548.1.29738 WP_003724548.1.29762 WP_003724548.1.29803 WP_003724548.1.29872 WP_003724548.1.29912 WP_003724548.1.30124 WP_003724548.1.30193 WP_003724548.1.30227 WP_003724548.1.30267 WP_003724548.1.30273 WP_003724548.1.30372 WP_003724548.1.30430 WP_003724548.1.305 WP_003724548.1.30660 WP_003724548.1.30706 WP_003724548.1.30827 WP_003724548.1.30837 WP_003724548.1.30851 WP_003724548.1.30882 WP_003724548.1.30902 WP_003724548.1.3103 WP_003724548.1.31062 WP_003724548.1.31108 WP_003724548.1.31116 WP_003724548.1.31289 WP_003724548.1.31305 WP_003724548.1.31329 WP_003724548.1.31444 WP_003724548.1.31485 WP_003724548.1.31584 WP_003724548.1.31691 WP_003724548.1.31830 WP_003724548.1.31966 WP_003724548.1.3206 WP_003724548.1.32061 WP_003724548.1.32140 WP_003724548.1.32209 WP_003724548.1.32210 WP_003724548.1.32240 WP_003724548.1.32278 WP_003724548.1.32402 WP_003724548.1.32472 WP_003724548.1.32597 WP_003724548.1.32622 WP_003724548.1.32648 WP_003724548.1.32681 WP_003724548.1.32698 WP_003724548.1.32767 WP_003724548.1.32817 WP_003724548.1.33016 WP_003724548.1.33039 WP_003724548.1.3314 WP_003724548.1.3324 WP_003724548.1.33282 WP_003724548.1.33336 WP_003724548.1.33591 WP_003724548.1.337 WP_003724548.1.33875 WP_003724548.1.3389 WP_003724548.1.3393 WP_003724548.1.33995 WP_003724548.1.34326 WP_003724548.1.34369 WP_003724548.1.34698 WP_003724548.1.34714 WP_003724548.1.34732 WP_003724548.1.34790 WP_003724548.1.34849 WP_003724548.1.34851 WP_003724548.1.34911 WP_003724548.1.3511 WP_003724548.1.35135 WP_003724548.1.35450 WP_003724548.1.35452 WP_003724548.1.35514 WP_003724548.1.35738 WP_003724548.1.35979 WP_003724548.1.36108 WP_003724548.1.36115 WP_003724548.1.3613 WP_003724548.1.36181 WP_003724548.1.36203 WP_003724548.1.36241 WP_003724548.1.364 WP_003724548.1.36582 WP_003724548.1.36749 WP_003724548.1.36877 WP_003724548.1.36936 WP_003724548.1.37023 WP_003724548.1.37426 WP_003724548.1.37466 WP_003724548.1.37471 WP_003724548.1.37518 WP_003724548.1.37561 WP_003724548.1.37665 WP_003724548.1.37723 WP_003724548.1.37882 WP_003724548.1.37900 WP_003724548.1.37927 WP_003724548.1.37951 WP_003724548.1.38015 WP_003724548.1.38025 WP_003724548.1.38076 WP_003724548.1.38150 WP_003724548.1.38224 WP_003724548.1.38281 WP_003724548.1.38302 WP_003724548.1.38382 WP_003724548.1.38396 WP_003724548.1.384 WP_003724548.1.38424 WP_003724548.1.38528 WP_003724548.1.3853 WP_003724548.1.38575 WP_003724548.1.38733 WP_003724548.1.38741 WP_003724548.1.38792 WP_003724548.1.38800 WP_003724548.1.38819 WP_003724548.1.38833 WP_003724548.1.3892 WP_003724548.1.39000 WP_003724548.1.39115 WP_003724548.1.3919 WP_003724548.1.39218 WP_003724548.1.39220 WP_003724548.1.39262 WP_003724548.1.39307 WP_003724548.1.39316 WP_003724548.1.39348 WP_003724548.1.39351 WP_003724548.1.39427 WP_003724548.1.39496 WP_003724548.1.39552 WP_003724548.1.3959 WP_003724548.1.39630 WP_003724548.1.39794 WP_003724548.1.39871 WP_003724548.1.39887 WP_003724548.1.39895 WP_003724548.1.40124 WP_003724548.1.40245 WP_003724548.1.40263 WP_003724548.1.404 WP_003724548.1.40420 WP_003724548.1.40504 WP_003724548.1.40556 WP_003724548.1.40580 WP_003724548.1.40720 WP_003724548.1.40820 WP_003724548.1.40841 WP_003724548.1.40953 WP_003724548.1.40976 WP_003724548.1.40978 WP_003724548.1.41023 WP_003724548.1.41222 WP_003724548.1.41281 WP_003724548.1.41337 WP_003724548.1.41348 WP_003724548.1.41603 WP_003724548.1.4166 WP_003724548.1.41700 WP_003724548.1.41876 WP_003724548.1.41903 WP_003724548.1.41909 WP_003724548.1.41955 WP_003724548.1.41970 WP_003724548.1.42010 WP_003724548.1.42040 WP_003724548.1.42089 WP_003724548.1.42127 WP_003724548.1.4218 WP_003724548.1.42317 WP_003724548.1.42339 WP_003724548.1.42525 WP_003724548.1.42550 WP_003724548.1.42616 WP_003724548.1.42672 WP_003724548.1.42958 WP_003724548.1.42994 WP_003724548.1.43135 WP_003724548.1.43267 WP_003724548.1.43304 WP_003724548.1.43327 WP_003724548.1.43336 WP_003724548.1.43350 WP_003724548.1.43458 WP_003724548.1.43480 WP_003724548.1.43619 WP_003724548.1.4371 WP_003724548.1.43768 WP_003724548.1.43807 WP_003724548.1.43916 WP_003724548.1.44023 WP_003724548.1.44092 WP_003724548.1.44106 WP_003724548.1.44147 WP_003724548.1.44161 WP_003724548.1.44230 WP_003724548.1.44427 WP_003724548.1.44596 WP_003724548.1.44645 WP_003724548.1.44663 WP_003724548.1.4472 WP_003724548.1.44749 WP_003724548.1.4479 WP_003724548.1.44806 WP_003724548.1.44897 WP_003724548.1.44924 WP_003724548.1.4503 WP_003724548.1.45295 WP_003724548.1.45309 WP_003724548.1.45355 WP_003724548.1.45512 WP_003724548.1.45524 WP_003724548.1.45541 WP_003724548.1.4557 WP_003724548.1.4562 WP_003724548.1.45708 WP_003724548.1.45719 WP_003724548.1.45758 WP_003724548.1.45759 WP_003724548.1.45778 WP_003724548.1.4578 WP_003724548.1.45811 WP_003724548.1.4587 WP_003724548.1.45877 WP_003724548.1.45893 WP_003724548.1.45983 WP_003724548.1.45994 WP_003724548.1.4604 WP_003724548.1.46045 WP_003724548.1.46064 WP_003724548.1.4615 WP_003724548.1.46154 WP_003724548.1.46180 WP_003724548.1.46277 WP_003724548.1.46314 WP_003724548.1.4642 WP_003724548.1.46425 WP_003724548.1.46456 WP_003724548.1.46566 WP_003724548.1.46653 WP_003724548.1.46711 WP_003724548.1.46725 WP_003724548.1.46863 WP_003724548.1.46867 WP_003724548.1.46883 WP_003724548.1.46981 WP_003724548.1.47001 WP_003724548.1.47055 WP_003724548.1.47075 WP_003724548.1.47203 WP_003724548.1.47384 WP_003724548.1.47412 WP_003724548.1.47431 WP_003724548.1.47518 WP_003724548.1.47520 WP_003724548.1.4753 WP_003724548.1.47593 WP_003724548.1.47650 WP_003724548.1.4766 WP_003724548.1.47738 WP_003724548.1.47759 WP_003724548.1.47952 WP_003724548.1.47953 WP_003724548.1.47979 WP_003724548.1.48007 WP_003724548.1.48161 WP_003724548.1.48163 WP_003724548.1.48175 WP_003724548.1.48180 WP_003724548.1.48358 WP_003724548.1.48410 WP_003724548.1.48435 WP_003724548.1.48440 WP_003724548.1.48441 WP_003724548.1.48471 WP_003724548.1.48565 WP_003724548.1.48572 WP_003724548.1.48624 WP_003724548.1.48661 WP_003724548.1.48854 WP_003724548.1.48999 WP_003724548.1.49 WP_003724548.1.49146 WP_003724548.1.49202 WP_003724548.1.49205 WP_003724548.1.49390 WP_003724548.1.49415 WP_003724548.1.49458 WP_003724548.1.49467 WP_003724548.1.49507 WP_003724548.1.49604 WP_003724548.1.49668 WP_003724548.1.49708 WP_003724548.1.4974 WP_003724548.1.49754 WP_003724548.1.49952 WP_003724548.1.49962 WP_003724548.1.50044 WP_003724548.1.50063 WP_003724548.1.50073 WP_003724548.1.5020 WP_003724548.1.50236 WP_003724548.1.50237 WP_003724548.1.50243 WP_003724548.1.50288 WP_003724548.1.50293 WP_003724548.1.50334 WP_003724548.1.50482 WP_003724548.1.50662 WP_003724548.1.50765 WP_003724548.1.50775 WP_003724548.1.50862 WP_003724548.1.50883 WP_003724548.1.50888 WP_003724548.1.50898 WP_003724548.1.50926 WP_003724548.1.50971 WP_003724548.1.5099 WP_003724548.1.51086 WP_003724548.1.51262 WP_003724548.1.5129 WP_003724548.1.51318 WP_003724548.1.51384 WP_003724548.1.51435 WP_003724548.1.51493 WP_003724548.1.51510 WP_003724548.1.51650 WP_003724548.1.5170 WP_003724548.1.51720 WP_003724548.1.51732 WP_003724548.1.51768 WP_003724548.1.51980 WP_003724548.1.52142 WP_003724548.1.52177 WP_003724548.1.52290 WP_003724548.1.52371 WP_003724548.1.52395 WP_003724548.1.52420 WP_003724548.1.52447 WP_003724548.1.52507 WP_003724548.1.52617 WP_003724548.1.52684 WP_003724548.1.52725 WP_003724548.1.52829 WP_003724548.1.52867 WP_003724548.1.52989 WP_003724548.1.53051 WP_003724548.1.53102 WP_003724548.1.53161 WP_003724548.1.5317 WP_003724548.1.53193 WP_003724548.1.53266 WP_003724548.1.53378 WP_003724548.1.53426 WP_003724548.1.53536 WP_003724548.1.53566 WP_003724548.1.53603 WP_003724548.1.53807 WP_003724548.1.53870 WP_003724548.1.53877 WP_003724548.1.53920 WP_003724548.1.54046 WP_003724548.1.54155 WP_003724548.1.54160 WP_003724548.1.5417 WP_003724548.1.54181 WP_003724548.1.54281 WP_003724548.1.54434 WP_003724548.1.54505 WP_003724548.1.54506 WP_003724548.1.54508 WP_003724548.1.54564 WP_003724548.1.54639 WP_003724548.1.54646 WP_003724548.1.5472 WP_003724548.1.54740 WP_003724548.1.54750 WP_003724548.1.54884 WP_003724548.1.55068 WP_003724548.1.5514 WP_003724548.1.55231 WP_003724548.1.55238 WP_003724548.1.5538 WP_003724548.1.55386 WP_003724548.1.55423 WP_003724548.1.55487 WP_003724548.1.55494 WP_003724548.1.55510 WP_003724548.1.55609 WP_003724548.1.55683 WP_003724548.1.55740 WP_003724548.1.55797 WP_003724548.1.55824 WP_003724548.1.55847 WP_003724548.1.55850 WP_003724548.1.55890 WP_003724548.1.5601 WP_003724548.1.56322 WP_003724548.1.56344 WP_003724548.1.56526 WP_003724548.1.56566 WP_003724548.1.5671 WP_003724548.1.56748 WP_003724548.1.56759 WP_003724548.1.5687 WP_003724548.1.56923 WP_003724548.1.57106 WP_003724548.1.57132 WP_003724548.1.57171 WP_003724548.1.57228 WP_003724548.1.57404 WP_003724548.1.57504 WP_003724548.1.57505 WP_003724548.1.57536 WP_003724548.1.57547 WP_003724548.1.57578 WP_003724548.1.57625 WP_003724548.1.57766 WP_003724548.1.57913 WP_003724548.1.57932 WP_003724548.1.57948 WP_003724548.1.57963 WP_003724548.1.57979 WP_003724548.1.58 WP_003724548.1.58030 WP_003724548.1.58069 WP_003724548.1.58083 WP_003724548.1.58088 WP_003724548.1.58177 WP_003724548.1.58491 WP_003724548.1.58516 WP_003724548.1.58532 WP_003724548.1.58661 WP_003724548.1.58828 WP_003724548.1.58966 WP_003724548.1.59045 WP_003724548.1.59113 WP_003724548.1.59343 WP_003724548.1.59353 WP_003724548.1.59477 WP_003724548.1.59493 WP_003724548.1.59542 WP_003724548.1.59571 WP_003724548.1.59652 WP_003724548.1.59695 WP_003724548.1.59720 WP_003724548.1.5973 WP_003724548.1.59744 WP_003724548.1.59799 WP_003724548.1.59937 WP_003724548.1.59949 WP_003724548.1.59975 WP_003724548.1.59984 WP_003724548.1.60132 WP_003724548.1.60162 WP_003724548.1.60166 WP_003724548.1.60191 WP_003724548.1.60219 WP_003724548.1.60258 WP_003724548.1.60297 WP_003724548.1.60346 WP_003724548.1.60369 WP_003724548.1.60543 WP_003724548.1.60665 WP_003724548.1.60674 WP_003724548.1.60762 WP_003724548.1.60766 WP_003724548.1.60768 WP_003724548.1.60956 WP_003724548.1.61002 WP_003724548.1.61072 WP_003724548.1.611 WP_003724548.1.61109 WP_003724548.1.61244 WP_003724548.1.61274 WP_003724548.1.61358 WP_003724548.1.61371 WP_003724548.1.61384 WP_003724548.1.61824 WP_003724548.1.61894 WP_003724548.1.61915 WP_003724548.1.62177 WP_003724548.1.6236 WP_003724548.1.62375 WP_003724548.1.62430 WP_003724548.1.62573 WP_003724548.1.62629 WP_003724548.1.62655 WP_003724548.1.62663 WP_003724548.1.6281 WP_003724548.1.62852 WP_003724548.1.62874 WP_003724548.1.62904 WP_003724548.1.62972 WP_003724548.1.63209 WP_003724548.1.63269 WP_003724548.1.63283 WP_003724548.1.63315 WP_003724548.1.63359 WP_003724548.1.63605 WP_003724548.1.63676 WP_003724548.1.63883 WP_003724548.1.63951 WP_003724548.1.6397 WP_003724548.1.64041 WP_003724548.1.64147 WP_003724548.1.64200 WP_003724548.1.64227 WP_003724548.1.64259 WP_003724548.1.64289 WP_003724548.1.64413 WP_003724548.1.64531 WP_003724548.1.64587 WP_003724548.1.6460 WP_003724548.1.64796 WP_003724548.1.648 WP_003724548.1.64929 WP_003724548.1.65143 WP_003724548.1.65213 WP_003724548.1.65309 WP_003724548.1.65376 WP_003724548.1.65392 WP_003724548.1.65561 WP_003724548.1.65730 WP_003724548.1.65780 WP_003724548.1.6579 WP_003724548.1.65913 WP_003724548.1.66005 WP_003724548.1.66057 WP_003724548.1.66134 WP_003724548.1.66138 WP_003724548.1.66184 WP_003724548.1.66285 WP_003724548.1.66296 WP_003724548.1.66311 WP_003724548.1.66338 WP_003724548.1.66510 WP_003724548.1.66512 WP_003724548.1.66545 WP_003724548.1.66596 WP_003724548.1.6672 WP_003724548.1.66743 WP_003724548.1.66884 WP_003724548.1.66903 WP_003724548.1.67165 WP_003724548.1.67301 WP_003724548.1.6731 WP_003724548.1.67352 WP_003724548.1.67408 WP_003724548.1.67429 WP_003724548.1.6745 WP_003724548.1.67551 WP_003724548.1.67573 WP_003724548.1.67610 WP_003724548.1.6763 WP_003724548.1.67654 WP_003724548.1.67668 WP_003724548.1.67694 WP_003724548.1.67709 WP_003724548.1.67795 WP_003724548.1.67813 WP_003724548.1.67884 WP_003724548.1.67926 WP_003724548.1.68112 WP_003724548.1.68123 WP_003724548.1.68128 WP_003724548.1.68197 WP_003724548.1.68208 WP_003724548.1.68236 WP_003724548.1.68282 WP_003724548.1.68301 WP_003724548.1.68414 WP_003724548.1.68497 WP_003724548.1.68517 WP_003724548.1.68525 WP_003724548.1.68528 WP_003724548.1.68740 WP_003724548.1.69263 WP_003724548.1.69265 WP_003724548.1.69471 WP_003724548.1.69570 WP_003724548.1.69579 WP_003724548.1.69587 WP_003724548.1.69603 WP_003724548.1.69631 WP_003724548.1.69727 WP_003724548.1.6982 WP_003724548.1.69864 WP_003724548.1.69989 WP_003724548.1.70100 WP_003724548.1.70104 WP_003724548.1.70122 WP_003724548.1.7026 WP_003724548.1.70309 WP_003724548.1.7031 WP_003724548.1.70373 WP_003724548.1.7051 WP_003724548.1.70588 WP_003724548.1.70633 WP_003724548.1.70690 WP_003724548.1.70736 WP_003724548.1.70992 WP_003724548.1.71381 WP_003724548.1.71437 WP_003724548.1.71468 WP_003724548.1.71474 WP_003724548.1.71585 WP_003724548.1.71726 WP_003724548.1.7175 WP_003724548.1.71753 WP_003724548.1.71763 WP_003724548.1.71858 WP_003724548.1.71904 WP_003724548.1.71921 WP_003724548.1.72051 WP_003724548.1.72057 WP_003724548.1.72116 WP_003724548.1.7218 WP_003724548.1.72228 WP_003724548.1.72264 WP_003724548.1.72370 WP_003724548.1.72385 WP_003724548.1.72467 WP_003724548.1.72546 WP_003724548.1.72558 WP_003724548.1.72566 WP_003724548.1.72623 WP_003724548.1.72636 WP_003724548.1.72813 WP_003724548.1.72841 WP_003724548.1.72886 WP_003724548.1.72918 WP_003724548.1.73152 WP_003724548.1.73222 WP_003724548.1.73263 WP_003724548.1.734 WP_003724548.1.73458 WP_003724548.1.73508 WP_003724548.1.73545 WP_003724548.1.73613 WP_003724548.1.73656 WP_003724548.1.73769 WP_003724548.1.74095 WP_003724548.1.74148 WP_003724548.1.7421 WP_003724548.1.74217 WP_003724548.1.74290 WP_003724548.1.74303 WP_003724548.1.74351 WP_003724548.1.74436 WP_003724548.1.74450 WP_003724548.1.7454 WP_003724548.1.74572 WP_003724548.1.74617 WP_003724548.1.74728 WP_003724548.1.74754 WP_003724548.1.74823 WP_003724548.1.74837 WP_003724548.1.74956 WP_003724548.1.7498 WP_003724548.1.75019 WP_003724548.1.7504 WP_003724548.1.75069 WP_003724548.1.75072 WP_003724548.1.75196 WP_003724548.1.75216 WP_003724548.1.75240 WP_003724548.1.7528 WP_003724548.1.7553 WP_003724548.1.75541 WP_003724548.1.75548 WP_003724548.1.75604 WP_003724548.1.7565 WP_003724548.1.75670 WP_003724548.1.75838 WP_003724548.1.75869 WP_003724548.1.75923 WP_003724548.1.76094 WP_003724548.1.76124 WP_003724548.1.76168 WP_003724548.1.76247 WP_003724548.1.76367 WP_003724548.1.76545 WP_003724548.1.76608 WP_003724548.1.76769 WP_003724548.1.76926 WP_003724548.1.76982 WP_003724548.1.77116 WP_003724548.1.77149 WP_003724548.1.7718 WP_003724548.1.77191 WP_003724548.1.77192 WP_003724548.1.77222 WP_003724548.1.77246 WP_003724548.1.77261 WP_003724548.1.77345 WP_003724548.1.77350 WP_003724548.1.7736 WP_003724548.1.7738 WP_003724548.1.77389 WP_003724548.1.77420 WP_003724548.1.77594 WP_003724548.1.77675 WP_003724548.1.77681 WP_003724548.1.77697 WP_003724548.1.77823 WP_003724548.1.77849 WP_003724548.1.77928 WP_003724548.1.77943 WP_003724548.1.78088 WP_003724548.1.78121 WP_003724548.1.78130 WP_003724548.1.78167 WP_003724548.1.78203 WP_003724548.1.78315 WP_003724548.1.7832 WP_003724548.1.78328 WP_003724548.1.78336 WP_003724548.1.78525 WP_003724548.1.78681 WP_003724548.1.78717 WP_003724548.1.79128 WP_003724548.1.79149 WP_003724548.1.79184 WP_003724548.1.79212 WP_003724548.1.79259 WP_003724548.1.79295 WP_003724548.1.7932 WP_003724548.1.79602 WP_003724548.1.79630 WP_003724548.1.79803 WP_003724548.1.79821 WP_003724548.1.79962 WP_003724548.1.79964 WP_003724548.1.80028 WP_003724548.1.80036 WP_003724548.1.80088 WP_003724548.1.80105 WP_003724548.1.80514 WP_003724548.1.80693 WP_003724548.1.80790 WP_003724548.1.80968 WP_003724548.1.81140 WP_003724548.1.81261 WP_003724548.1.81270 WP_003724548.1.81315 WP_003724548.1.81476 WP_003724548.1.81495 WP_003724548.1.81503 WP_003724548.1.8151 WP_003724548.1.81647 WP_003724548.1.81662 WP_003724548.1.81693 WP_003724548.1.81713 WP_003724548.1.81725 WP_003724548.1.81833 WP_003724548.1.81863 WP_003724548.1.82274 WP_003724548.1.82294 WP_003724548.1.82372 WP_003724548.1.82440 WP_003724548.1.82605 WP_003724548.1.82616 WP_003724548.1.82662 WP_003724548.1.82667 WP_003724548.1.82719 WP_003724548.1.82821 WP_003724548.1.82893 WP_003724548.1.82951 WP_003724548.1.82974 WP_003724548.1.83015 WP_003724548.1.83030 WP_003724548.1.83130 WP_003724548.1.83137 WP_003724548.1.83215 WP_003724548.1.83217 WP_003724548.1.83236 WP_003724548.1.83260 WP_003724548.1.83323 WP_003724548.1.83350 WP_003724548.1.83478 WP_003724548.1.83542 WP_003724548.1.83546 WP_003724548.1.83607 WP_003724548.1.83755 WP_003724548.1.83809 WP_003724548.1.83877 WP_003724548.1.83907 WP_003724548.1.8391 WP_003724548.1.83932 WP_003724548.1.8418 WP_003724548.1.84180 WP_003724548.1.84265 WP_003724548.1.84320 WP_003724548.1.84367 WP_003724548.1.84539 WP_003724548.1.84579 WP_003724548.1.84586 WP_003724548.1.84588 WP_003724548.1.8465 WP_003724548.1.8473 WP_003724548.1.84781 WP_003724548.1.84833 WP_003724548.1.84895 WP_003724548.1.84974 WP_003724548.1.84980 WP_003724548.1.85036 WP_003724548.1.85172 WP_003724548.1.85194 WP_003724548.1.85203 WP_003724548.1.85317 WP_003724548.1.85321 WP_003724548.1.8539 WP_003724548.1.85576 WP_003724548.1.85690 WP_003724548.1.85887 WP_003724548.1.85890 WP_003724548.1.8593 WP_003724548.1.86056 WP_003724548.1.86098 WP_003724548.1.86232 WP_003724548.1.86253 WP_003724548.1.86279 WP_003724548.1.86308 WP_003724548.1.86484 WP_003724548.1.86571 WP_003724548.1.86597 WP_003724548.1.866 WP_003724548.1.86683 WP_003724548.1.86752 WP_003724548.1.86958 WP_003724548.1.87085 WP_003724548.1.8710 WP_003724548.1.87101 WP_003724548.1.87108 WP_003724548.1.8715 WP_003724548.1.87154 WP_003724548.1.87179 WP_003724548.1.87294 WP_003724548.1.87328 WP_003724548.1.87329 WP_003724548.1.87436 WP_003724548.1.87536 WP_003724548.1.87537 WP_003724548.1.87701 WP_003724548.1.8782 WP_003724548.1.87890 WP_003724548.1.87903 WP_003724548.1.87920 WP_003724548.1.88015 WP_003724548.1.88055 WP_003724548.1.88063 WP_003724548.1.88112 WP_003724548.1.88128 WP_003724548.1.88211 WP_003724548.1.88397 WP_003724548.1.88422 WP_003724548.1.88463 WP_003724548.1.88485 WP_003724548.1.88584 WP_003724548.1.88589 WP_003724548.1.88639 WP_003724548.1.88768 WP_003724548.1.88783 WP_003724548.1.88800 WP_003724548.1.88806 WP_003724548.1.8884 WP_003724548.1.88877 WP_003724548.1.88890 WP_003724548.1.88895 WP_003724548.1.88974 WP_003724548.1.89085 WP_003724548.1.89160 WP_003724548.1.89267 WP_003724548.1.89302 WP_003724548.1.8932 WP_003724548.1.89386 WP_003724548.1.89387 WP_003724548.1.89443 WP_003724548.1.89450 WP_003724548.1.89478 WP_003724548.1.89505 WP_003724548.1.89809 WP_003724548.1.89812 WP_003724548.1.89897 WP_003724548.1.89916 WP_003724548.1.89969 WP_003724548.1.90086 WP_003724548.1.90135 WP_003724548.1.9019 WP_003724548.1.90201 WP_003724548.1.90212 WP_003724548.1.90326 WP_003724548.1.90459 WP_003724548.1.90524 WP_003724548.1.90567 WP_003724548.1.90646 WP_003724548.1.90741 WP_003724548.1.90821 WP_003724548.1.90829 WP_003724548.1.90857 WP_003724548.1.90963 WP_003724548.1.91084 WP_003724548.1.9109 WP_003724548.1.91140 WP_003724548.1.91168 WP_003724548.1.91195 WP_003724548.1.91212 WP_003724548.1.91443 WP_003724548.1.91514 WP_003724548.1.91556 WP_003724548.1.91560 WP_003724548.1.91765 WP_003724548.1.91920 WP_003724548.1.91922 WP_003724548.1.92049 WP_003724548.1.92132 WP_003724548.1.92142 WP_003724548.1.92148 WP_003724548.1.92274 WP_003724548.1.92288 WP_003724548.1.92370 WP_003724548.1.92409 WP_003724548.1.9243 WP_003724548.1.92494 WP_003724548.1.92548 WP_003724548.1.92591 WP_003724548.1.92595 WP_003724548.1.9282 WP_003724548.1.92928 WP_003724548.1.92963 WP_003724548.1.93014 WP_003724548.1.93049 WP_003724548.1.93217 WP_003724548.1.93325 WP_003724548.1.93421 WP_003724548.1.93490 WP_003724548.1.93534 WP_003724548.1.93556 WP_003724548.1.93558 WP_003724548.1.93611 WP_003724548.1.93712 WP_003724548.1.93777 WP_003724548.1.93859 WP_003724548.1.93867 WP_003724548.1.93895 WP_003724548.1.93920 WP_003724548.1.93997 WP_003724548.1.94026 WP_003724548.1.94032 WP_003724548.1.94058 WP_003724548.1.94059 WP_003724548.1.94081 WP_003724548.1.94191 WP_003724548.1.94206 WP_003724548.1.94225 WP_003724548.1.94233 WP_003724548.1.94336 WP_003724548.1.94401 WP_003724548.1.94431 WP_003724548.1.94447 WP_003724548.1.94464 WP_003724548.1.94537 WP_003724548.1.94554 WP_003724548.1.94613 WP_003724548.1.9470 WP_003724548.1.94758 WP_003724548.1.94759 WP_003724548.1.94795 WP_003724548.1.94906 WP_003724548.1.94961 WP_003724548.1.9502 WP_003724548.1.9505 WP_003724548.1.95100 WP_003724548.1.95146 WP_003724548.1.95162 WP_003724548.1.9517 WP_003724548.1.95186 WP_003724548.1.95197 WP_003724548.1.95256 WP_003724548.1.95702 WP_003724548.1.95715 WP_003724548.1.95945 WP_003724548.1.96033 WP_003724548.1.96084 WP_003724548.1.96140 WP_003724548.1.96156 WP_003724548.1.96296 WP_003724548.1.96407 WP_003724548.1.96422 WP_003724548.1.9643 WP_003724548.1.96438 WP_003724548.1.96449 WP_003724548.1.96496 WP_003724548.1.96542 WP_003724548.1.96544 WP_003724548.1.96586 WP_003724548.1.96596 WP_003724548.1.96605 WP_003724548.1.96708 WP_003724548.1.9672 WP_003724548.1.96751 WP_003724548.1.96835 WP_003724548.1.96867 WP_003724548.1.96874 WP_003724548.1.96940 WP_003724548.1.97140 WP_003724548.1.97165 WP_003724548.1.97199 WP_003724548.1.97257 WP_003724548.1.97315 WP_003724548.1.9732 WP_003724548.1.97390 WP_003724548.1.97469 WP_003724548.1.97569 WP_003724548.1.97587 WP_003724548.1.97589 WP_003724548.1.97633 WP_003724548.1.9768 WP_003724548.1.9769 WP_003724548.1.97752 WP_003724548.1.97803 WP_003724548.1.97820 WP_003724548.1.97900 WP_003724548.1.97970 WP_003724548.1.9802 WP_003724548.1.98038 WP_003724548.1.98042 WP_003724548.1.98060 WP_003724548.1.98193 WP_003724548.1.98331 WP_003724548.1.98351 WP_003724548.1.98375 WP_003724548.1.98490 WP_003724548.1.98689 WP_003724548.1.98826 WP_003724548.1.98829 WP_003724548.1.98866 WP_003724548.1.9894 WP_003724548.1.98974 WP_003724548.1.99026 WP_003724548.1.9916 WP_003724548.1.99199 WP_003724548.1.99357 WP_003724548.1.99409 WP_003724548.1.99512 WP_003724548.1.99518 WP_003724548.1.99520 WP_003724548.1.99521 WP_003724548.1.99527 WP_003724548.1.99553 WP_003724548.1.99568 WP_003724548.1.99663 WP_003724548.1.99702 WP_003724548.1.99737 WP_003724548.1.99785 WP_003724548.1.99786 WP_003724548.1.99818 WP_003724548.1.99836 WP_003724548.1.99906 WP_003724548.1.99914 WP_003724548.1.99921 WP_003724548.1.99974 gi|404408565|ref|YP_006691280.1| gi|386027514|ref|YP_005948290.1| gi|405753358|ref|YP_006676823.1| gi|404281742|ref|YP_006682640.1| gi|404287555|ref|YP_006694141.1| gi|386044436|ref|YP_005963241.1| gi|284995714|ref|YP_003417482.1| gi|386051101|ref|YP_005969092.1| gi|550898356|ref|YP_008667852.1| gi|525734484|ref|YP_008290381.1| gi|525722753|ref|YP_008287432.1| gi|284802572|ref|YP_003414437.1| gi|405759177|ref|YP_006688453.1| gi|404284623|ref|YP_006685520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]