SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386009133|ref|YP_005927411.1| from Listeria monocytogenes L99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386009133|ref|YP_005927411.1|
Domain Number 1 Region: 35-274
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.64e-73
Family Phosphate binding protein-like 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386009133|ref|YP_005927411.1|
Sequence length 276
Comment D-methionine ABC transporter, substrate-binding protein [Listeria monocytogenes L99]
Sequence
MKKVLGFIFTLSLVLVLTACGSSSDKASSSKDDNQLVVGASNTPHAQILEQAKPILKDKG
IDLKIVKYTDYVMPNKALEEGDLDANYFQHKPYLELEEKEKGYKFADVGAIHIEPMGIYS
KKVKDIKDLKDGAQVLLSNSKSDWPRVIGIFVDNGLLTLKDGVKPQDATFDDIKDNPKNL
KFKYDFDPAYLMTAYNNEEGDVVAINSNFVVDQGLNPSKDAIAIESKDSPYANIVVTTEK
KKDDKNIKELVKVLHSKEIQDYITKEWDGAVVPVDK
Download sequence
Identical sequences A0A0E0UYC7
gi|386027744|ref|YP_005948520.1| gi|386009133|ref|YP_005927411.1| gi|217963483|ref|YP_002349161.1| WP_003730031.1.100060 WP_003730031.1.100651 WP_003730031.1.100835 WP_003730031.1.11633 WP_003730031.1.12634 WP_003730031.1.13234 WP_003730031.1.13329 WP_003730031.1.19626 WP_003730031.1.22383 WP_003730031.1.22468 WP_003730031.1.23419 WP_003730031.1.25788 WP_003730031.1.26166 WP_003730031.1.2662 WP_003730031.1.28076 WP_003730031.1.2832 WP_003730031.1.30706 WP_003730031.1.33039 WP_003730031.1.33240 WP_003730031.1.3389 WP_003730031.1.36582 WP_003730031.1.38281 WP_003730031.1.39220 WP_003730031.1.39552 WP_003730031.1.40504 WP_003730031.1.41603 WP_003730031.1.42616 WP_003730031.1.44147 WP_003730031.1.4510 WP_003730031.1.4557 WP_003730031.1.45759 WP_003730031.1.45803 WP_003730031.1.46064 WP_003730031.1.4642 WP_003730031.1.47203 WP_003730031.1.5099 WP_003730031.1.51980 WP_003730031.1.53566 WP_003730031.1.53870 WP_003730031.1.5472 WP_003730031.1.5538 WP_003730031.1.5631 WP_003730031.1.58516 WP_003730031.1.60297 WP_003730031.1.61824 WP_003730031.1.66296 WP_003730031.1.69587 WP_003730031.1.70373 WP_003730031.1.73458 WP_003730031.1.74303 WP_003730031.1.75019 WP_003730031.1.79295 WP_003730031.1.79962 WP_003730031.1.80088 WP_003730031.1.81693 WP_003730031.1.81725 WP_003730031.1.81833 WP_003730031.1.82616 WP_003730031.1.89127 WP_003730031.1.90135 WP_003730031.1.91212 WP_003730031.1.95256 WP_003730031.1.97257 WP_003730031.1.98375 gi|404408792|ref|YP_006691507.1| 552536.LMHCC_0185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]