SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386009216|ref|YP_005927494.1| from Listeria monocytogenes L99

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386009216|ref|YP_005927494.1|
Domain Number 1 Region: 46-292
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.88e-72
Family Phosphate binding protein-like 0.0000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386009216|ref|YP_005927494.1|
Sequence length 302
Comment phosphate ABC transporter substrate-binding protein [Listeria monocytogenes L99]
Sequence
MKKKYLGIVAMLAAVMLVFAACGSDSSSSDKANGSTKGDKEVSGSLTAVGSTALQPLVEA
ASKEFINTNPKAQINVQGGGSGTGLTQVQQGAVEIGNSDVFAEEKDGVDASKLVDHRVAV
VGMAPVVNKDVGVKNITKQQLIDIFTGKTTNWKDVGGKDEKITIINRAEGSGTRATFEKW
GLDGKTPVKAQEQDSSGTVRKIVSETPGAISYLAFSYIDASVVGLSLDGVEPTEDKVATN
DWKIWSYEHMYTNGEPKGLTKTFLKYMTSDEVQNNIVPQLGYQSIKSMKVERDASGKLTD
VK
Download sequence
Identical sequences A0A0B8RBK3 A0A0E0UYY1 A0A241SSY1 A0A2G8Q1C2
265669.LMOf2365_2472 552536.LMHCC_0101 634178.Lm4b_02468 gi|404287870|ref|YP_006694456.1| gi|405750844|ref|YP_006674310.1| gi|386733183|ref|YP_006206679.1| gi|217963399|ref|YP_002349077.1| gi|226225047|ref|YP_002759154.1| gi|404282057|ref|YP_006682955.1| gi|405756611|ref|YP_006680075.1| gi|525722459|ref|YP_008287063.1| gi|284996078|ref|YP_003417846.1| gi|525734777|ref|YP_008290732.1| gi|46908671|ref|YP_015060.1| WP_003725429.1.100060 WP_003725429.1.100078 WP_003725429.1.100142 WP_003725429.1.100160 WP_003725429.1.100221 WP_003725429.1.100261 WP_003725429.1.10039 WP_003725429.1.100458 WP_003725429.1.100522 WP_003725429.1.100651 WP_003725429.1.10073 WP_003725429.1.100835 WP_003725429.1.101057 WP_003725429.1.101093 WP_003725429.1.101318 WP_003725429.1.101527 WP_003725429.1.101529 WP_003725429.1.101688 WP_003725429.1.10176 WP_003725429.1.101772 WP_003725429.1.101811 WP_003725429.1.10182 WP_003725429.1.101945 WP_003725429.1.10198 WP_003725429.1.10210 WP_003725429.1.102145 WP_003725429.1.102150 WP_003725429.1.10418 WP_003725429.1.10444 WP_003725429.1.10460 WP_003725429.1.10484 WP_003725429.1.11086 WP_003725429.1.1123 WP_003725429.1.1146 WP_003725429.1.1160 WP_003725429.1.11633 WP_003725429.1.11689 WP_003725429.1.11738 WP_003725429.1.11788 WP_003725429.1.12020 WP_003725429.1.12028 WP_003725429.1.12142 WP_003725429.1.12148 WP_003725429.1.12278 WP_003725429.1.12287 WP_003725429.1.12417 WP_003725429.1.12544 WP_003725429.1.12634 WP_003725429.1.12993 WP_003725429.1.13004 WP_003725429.1.13052 WP_003725429.1.13180 WP_003725429.1.13234 WP_003725429.1.13329 WP_003725429.1.13360 WP_003725429.1.13684 WP_003725429.1.13779 WP_003725429.1.13847 WP_003725429.1.13855 WP_003725429.1.13921 WP_003725429.1.14072 WP_003725429.1.14103 WP_003725429.1.14339 WP_003725429.1.14636 WP_003725429.1.14641 WP_003725429.1.14832 WP_003725429.1.14875 WP_003725429.1.14895 WP_003725429.1.15085 WP_003725429.1.15122 WP_003725429.1.15340 WP_003725429.1.15342 WP_003725429.1.15495 WP_003725429.1.155 WP_003725429.1.15518 WP_003725429.1.1556 WP_003725429.1.15564 WP_003725429.1.15618 WP_003725429.1.15619 WP_003725429.1.15659 WP_003725429.1.1575 WP_003725429.1.15847 WP_003725429.1.16403 WP_003725429.1.16516 WP_003725429.1.16631 WP_003725429.1.1667 WP_003725429.1.16726 WP_003725429.1.16746 WP_003725429.1.1678 WP_003725429.1.1688 WP_003725429.1.17106 WP_003725429.1.17131 WP_003725429.1.17352 WP_003725429.1.17398 WP_003725429.1.17399 WP_003725429.1.1764 WP_003725429.1.17774 WP_003725429.1.1794 WP_003725429.1.18026 WP_003725429.1.18046 WP_003725429.1.18289 WP_003725429.1.18463 WP_003725429.1.18677 WP_003725429.1.18721 WP_003725429.1.18833 WP_003725429.1.19112 WP_003725429.1.19167 WP_003725429.1.19189 WP_003725429.1.19195 WP_003725429.1.19246 WP_003725429.1.1929 WP_003725429.1.19372 WP_003725429.1.19443 WP_003725429.1.19452 WP_003725429.1.19472 WP_003725429.1.19542 WP_003725429.1.19548 WP_003725429.1.19549 WP_003725429.1.19584 WP_003725429.1.19607 WP_003725429.1.19615 WP_003725429.1.19626 WP_003725429.1.19685 WP_003725429.1.197 WP_003725429.1.20263 WP_003725429.1.20378 WP_003725429.1.20402 WP_003725429.1.20548 WP_003725429.1.20672 WP_003725429.1.21099 WP_003725429.1.21338 WP_003725429.1.21371 WP_003725429.1.21428 WP_003725429.1.21429 WP_003725429.1.21527 WP_003725429.1.21529 WP_003725429.1.21542 WP_003725429.1.21567 WP_003725429.1.21597 WP_003725429.1.21706 WP_003725429.1.21711 WP_003725429.1.21874 WP_003725429.1.21889 WP_003725429.1.22099 WP_003725429.1.22188 WP_003725429.1.22194 WP_003725429.1.22202 WP_003725429.1.22221 WP_003725429.1.22468 WP_003725429.1.22597 WP_003725429.1.22776 WP_003725429.1.22962 WP_003725429.1.23060 WP_003725429.1.23139 WP_003725429.1.23255 WP_003725429.1.23291 WP_003725429.1.233 WP_003725429.1.23419 WP_003725429.1.23425 WP_003725429.1.23433 WP_003725429.1.23448 WP_003725429.1.23650 WP_003725429.1.23781 WP_003725429.1.23828 WP_003725429.1.23848 WP_003725429.1.24048 WP_003725429.1.24075 WP_003725429.1.24115 WP_003725429.1.24335 WP_003725429.1.24411 WP_003725429.1.24422 WP_003725429.1.24531 WP_003725429.1.24546 WP_003725429.1.24600 WP_003725429.1.24667 WP_003725429.1.24847 WP_003725429.1.24867 WP_003725429.1.24934 WP_003725429.1.24975 WP_003725429.1.25300 WP_003725429.1.2545 WP_003725429.1.25456 WP_003725429.1.25471 WP_003725429.1.25500 WP_003725429.1.25616 WP_003725429.1.25746 WP_003725429.1.25788 WP_003725429.1.25805 WP_003725429.1.25830 WP_003725429.1.25896 WP_003725429.1.26060 WP_003725429.1.26138 WP_003725429.1.26166 WP_003725429.1.26170 WP_003725429.1.26322 WP_003725429.1.26523 WP_003725429.1.2662 WP_003725429.1.26634 WP_003725429.1.2666 WP_003725429.1.26957 WP_003725429.1.27056 WP_003725429.1.27132 WP_003725429.1.27143 WP_003725429.1.27517 WP_003725429.1.27669 WP_003725429.1.27681 WP_003725429.1.27728 WP_003725429.1.27826 WP_003725429.1.27839 WP_003725429.1.27860 WP_003725429.1.27891 WP_003725429.1.27948 WP_003725429.1.28060 WP_003725429.1.28076 WP_003725429.1.28098 WP_003725429.1.28123 WP_003725429.1.2824 WP_003725429.1.28260 WP_003725429.1.28325 WP_003725429.1.28369 WP_003725429.1.2855 WP_003725429.1.28722 WP_003725429.1.28792 WP_003725429.1.28804 WP_003725429.1.28818 WP_003725429.1.29309 WP_003725429.1.29558 WP_003725429.1.29562 WP_003725429.1.29565 WP_003725429.1.29569 WP_003725429.1.29634 WP_003725429.1.29723 WP_003725429.1.29803 WP_003725429.1.30124 WP_003725429.1.30273 WP_003725429.1.30372 WP_003725429.1.30430 WP_003725429.1.30660 WP_003725429.1.30706 WP_003725429.1.30827 WP_003725429.1.30837 WP_003725429.1.30851 WP_003725429.1.30882 WP_003725429.1.30902 WP_003725429.1.3103 WP_003725429.1.31062 WP_003725429.1.31289 WP_003725429.1.31305 WP_003725429.1.31329 WP_003725429.1.31691 WP_003725429.1.31966 WP_003725429.1.3206 WP_003725429.1.32061 WP_003725429.1.32140 WP_003725429.1.32209 WP_003725429.1.32240 WP_003725429.1.32472 WP_003725429.1.32597 WP_003725429.1.32648 WP_003725429.1.32681 WP_003725429.1.32698 WP_003725429.1.32767 WP_003725429.1.32817 WP_003725429.1.33016 WP_003725429.1.33039 WP_003725429.1.3314 WP_003725429.1.33240 WP_003725429.1.33282 WP_003725429.1.33591 WP_003725429.1.337 WP_003725429.1.3389 WP_003725429.1.3393 WP_003725429.1.34326 WP_003725429.1.34369 WP_003725429.1.34698 WP_003725429.1.34714 WP_003725429.1.34790 WP_003725429.1.34911 WP_003725429.1.35350 WP_003725429.1.35452 WP_003725429.1.35514 WP_003725429.1.35738 WP_003725429.1.35979 WP_003725429.1.36108 WP_003725429.1.36115 WP_003725429.1.3613 WP_003725429.1.36582 WP_003725429.1.36749 WP_003725429.1.37023 WP_003725429.1.37426 WP_003725429.1.37466 WP_003725429.1.37471 WP_003725429.1.37665 WP_003725429.1.37723 WP_003725429.1.37882 WP_003725429.1.37900 WP_003725429.1.37927 WP_003725429.1.37951 WP_003725429.1.37986 WP_003725429.1.38015 WP_003725429.1.38150 WP_003725429.1.38281 WP_003725429.1.38302 WP_003725429.1.38382 WP_003725429.1.38396 WP_003725429.1.384 WP_003725429.1.38424 WP_003725429.1.38528 WP_003725429.1.38575 WP_003725429.1.38741 WP_003725429.1.38792 WP_003725429.1.38800 WP_003725429.1.38819 WP_003725429.1.3892 WP_003725429.1.39000 WP_003725429.1.39115 WP_003725429.1.39218 WP_003725429.1.39220 WP_003725429.1.39262 WP_003725429.1.39307 WP_003725429.1.39316 WP_003725429.1.39348 WP_003725429.1.39351 WP_003725429.1.39427 WP_003725429.1.39496 WP_003725429.1.39794 WP_003725429.1.39871 WP_003725429.1.39895 WP_003725429.1.40245 WP_003725429.1.40263 WP_003725429.1.404 WP_003725429.1.40420 WP_003725429.1.40504 WP_003725429.1.40556 WP_003725429.1.40580 WP_003725429.1.40841 WP_003725429.1.40976 WP_003725429.1.40978 WP_003725429.1.41023 WP_003725429.1.41222 WP_003725429.1.41337 WP_003725429.1.41603 WP_003725429.1.4166 WP_003725429.1.41700 WP_003725429.1.41876 WP_003725429.1.41970 WP_003725429.1.42040 WP_003725429.1.42089 WP_003725429.1.42310 WP_003725429.1.42317 WP_003725429.1.42339 WP_003725429.1.42525 WP_003725429.1.42550 WP_003725429.1.42564 WP_003725429.1.42926 WP_003725429.1.42994 WP_003725429.1.43060 WP_003725429.1.43135 WP_003725429.1.43304 WP_003725429.1.43327 WP_003725429.1.43336 WP_003725429.1.43350 WP_003725429.1.43458 WP_003725429.1.43480 WP_003725429.1.43768 WP_003725429.1.43807 WP_003725429.1.43916 WP_003725429.1.44092 WP_003725429.1.44147 WP_003725429.1.44161 WP_003725429.1.44230 WP_003725429.1.44427 WP_003725429.1.44596 WP_003725429.1.44663 WP_003725429.1.44703 WP_003725429.1.4472 WP_003725429.1.44749 WP_003725429.1.44806 WP_003725429.1.44897 WP_003725429.1.4503 WP_003725429.1.4510 WP_003725429.1.45295 WP_003725429.1.45355 WP_003725429.1.45512 WP_003725429.1.45541 WP_003725429.1.4557 WP_003725429.1.4562 WP_003725429.1.45719 WP_003725429.1.45759 WP_003725429.1.45778 WP_003725429.1.4578 WP_003725429.1.45803 WP_003725429.1.4587 WP_003725429.1.45877 WP_003725429.1.45883 WP_003725429.1.45893 WP_003725429.1.46045 WP_003725429.1.46064 WP_003725429.1.46154 WP_003725429.1.46180 WP_003725429.1.46277 WP_003725429.1.46314 WP_003725429.1.4642 WP_003725429.1.46425 WP_003725429.1.46456 WP_003725429.1.46566 WP_003725429.1.46711 WP_003725429.1.46725 WP_003725429.1.46834 WP_003725429.1.46867 WP_003725429.1.46883 WP_003725429.1.46981 WP_003725429.1.47001 WP_003725429.1.47075 WP_003725429.1.47203 WP_003725429.1.47384 WP_003725429.1.47431 WP_003725429.1.47518 WP_003725429.1.47520 WP_003725429.1.4753 WP_003725429.1.47650 WP_003725429.1.47738 WP_003725429.1.47759 WP_003725429.1.47952 WP_003725429.1.47979 WP_003725429.1.48007 WP_003725429.1.48161 WP_003725429.1.48163 WP_003725429.1.48175 WP_003725429.1.48235 WP_003725429.1.48410 WP_003725429.1.48440 WP_003725429.1.48441 WP_003725429.1.48565 WP_003725429.1.48624 WP_003725429.1.48854 WP_003725429.1.49 WP_003725429.1.49390 WP_003725429.1.49391 WP_003725429.1.49458 WP_003725429.1.49507 WP_003725429.1.49708 WP_003725429.1.4974 WP_003725429.1.49754 WP_003725429.1.50044 WP_003725429.1.50063 WP_003725429.1.50073 WP_003725429.1.50288 WP_003725429.1.50293 WP_003725429.1.50482 WP_003725429.1.50662 WP_003725429.1.50765 WP_003725429.1.50775 WP_003725429.1.50862 WP_003725429.1.50926 WP_003725429.1.50971 WP_003725429.1.5099 WP_003725429.1.51086 WP_003725429.1.51262 WP_003725429.1.51384 WP_003725429.1.51435 WP_003725429.1.51493 WP_003725429.1.5170 WP_003725429.1.51768 WP_003725429.1.51980 WP_003725429.1.52142 WP_003725429.1.52290 WP_003725429.1.52371 WP_003725429.1.52420 WP_003725429.1.52507 WP_003725429.1.52725 WP_003725429.1.52782 WP_003725429.1.52829 WP_003725429.1.53051 WP_003725429.1.53102 WP_003725429.1.53161 WP_003725429.1.53193 WP_003725429.1.53426 WP_003725429.1.53536 WP_003725429.1.53566 WP_003725429.1.53603 WP_003725429.1.53807 WP_003725429.1.53870 WP_003725429.1.54046 WP_003725429.1.54181 WP_003725429.1.54281 WP_003725429.1.54434 WP_003725429.1.54505 WP_003725429.1.54506 WP_003725429.1.54508 WP_003725429.1.5472 WP_003725429.1.54740 WP_003725429.1.54750 WP_003725429.1.54884 WP_003725429.1.55027 WP_003725429.1.55068 WP_003725429.1.5514 WP_003725429.1.55231 WP_003725429.1.5538 WP_003725429.1.55386 WP_003725429.1.55423 WP_003725429.1.55494 WP_003725429.1.55510 WP_003725429.1.55609 WP_003725429.1.55850 WP_003725429.1.5631 WP_003725429.1.56322 WP_003725429.1.56344 WP_003725429.1.56566 WP_003725429.1.5671 WP_003725429.1.56748 WP_003725429.1.5687 WP_003725429.1.56923 WP_003725429.1.57106 WP_003725429.1.57228 WP_003725429.1.57374 WP_003725429.1.57504 WP_003725429.1.57536 WP_003725429.1.57913 WP_003725429.1.57932 WP_003725429.1.58 WP_003725429.1.58083 WP_003725429.1.58088 WP_003725429.1.58491 WP_003725429.1.58516 WP_003725429.1.58966 WP_003725429.1.59113 WP_003725429.1.59353 WP_003725429.1.59493 WP_003725429.1.59542 WP_003725429.1.59571 WP_003725429.1.59652 WP_003725429.1.59695 WP_003725429.1.59720 WP_003725429.1.59744 WP_003725429.1.59826 WP_003725429.1.59975 WP_003725429.1.60132 WP_003725429.1.60162 WP_003725429.1.60258 WP_003725429.1.60295 WP_003725429.1.60297 WP_003725429.1.60543 WP_003725429.1.60674 WP_003725429.1.60762 WP_003725429.1.60766 WP_003725429.1.60768 WP_003725429.1.60956 WP_003725429.1.61072 WP_003725429.1.611 WP_003725429.1.61274 WP_003725429.1.61358 WP_003725429.1.61371 WP_003725429.1.61384 WP_003725429.1.61525 WP_003725429.1.61824 WP_003725429.1.61894 WP_003725429.1.61915 WP_003725429.1.6236 WP_003725429.1.62375 WP_003725429.1.62494 WP_003725429.1.62573 WP_003725429.1.62629 WP_003725429.1.62690 WP_003725429.1.6281 WP_003725429.1.62852 WP_003725429.1.62874 WP_003725429.1.63209 WP_003725429.1.63269 WP_003725429.1.63283 WP_003725429.1.63315 WP_003725429.1.63605 WP_003725429.1.63842 WP_003725429.1.63883 WP_003725429.1.64147 WP_003725429.1.64289 WP_003725429.1.64413 WP_003725429.1.64531 WP_003725429.1.64587 WP_003725429.1.64796 WP_003725429.1.64869 WP_003725429.1.64929 WP_003725429.1.65143 WP_003725429.1.65376 WP_003725429.1.65392 WP_003725429.1.65561 WP_003725429.1.65780 WP_003725429.1.65913 WP_003725429.1.66057 WP_003725429.1.66134 WP_003725429.1.66138 WP_003725429.1.66285 WP_003725429.1.66296 WP_003725429.1.66510 WP_003725429.1.66545 WP_003725429.1.66596 WP_003725429.1.66743 WP_003725429.1.66993 WP_003725429.1.6745 WP_003725429.1.67551 WP_003725429.1.67573 WP_003725429.1.67610 WP_003725429.1.67654 WP_003725429.1.67795 WP_003725429.1.67813 WP_003725429.1.67884 WP_003725429.1.67926 WP_003725429.1.68128 WP_003725429.1.68208 WP_003725429.1.68236 WP_003725429.1.68282 WP_003725429.1.68497 WP_003725429.1.68517 WP_003725429.1.68525 WP_003725429.1.68528 WP_003725429.1.68740 WP_003725429.1.69263 WP_003725429.1.69360 WP_003725429.1.69587 WP_003725429.1.69603 WP_003725429.1.69864 WP_003725429.1.6991 WP_003725429.1.69989 WP_003725429.1.70100 WP_003725429.1.70122 WP_003725429.1.7026 WP_003725429.1.70309 WP_003725429.1.7031 WP_003725429.1.70373 WP_003725429.1.70590 WP_003725429.1.70633 WP_003725429.1.70736 WP_003725429.1.71381 WP_003725429.1.71437 WP_003725429.1.71474 WP_003725429.1.71585 WP_003725429.1.71726 WP_003725429.1.7175 WP_003725429.1.71763 WP_003725429.1.71858 WP_003725429.1.71904 WP_003725429.1.71921 WP_003725429.1.72057 WP_003725429.1.72264 WP_003725429.1.72370 WP_003725429.1.72546 WP_003725429.1.72623 WP_003725429.1.72813 WP_003725429.1.72886 WP_003725429.1.72918 WP_003725429.1.73152 WP_003725429.1.73222 WP_003725429.1.73263 WP_003725429.1.73448 WP_003725429.1.73458 WP_003725429.1.73508 WP_003725429.1.73545 WP_003725429.1.73613 WP_003725429.1.73656 WP_003725429.1.74095 WP_003725429.1.74148 WP_003725429.1.7421 WP_003725429.1.74290 WP_003725429.1.74303 WP_003725429.1.74351 WP_003725429.1.74436 WP_003725429.1.74617 WP_003725429.1.74728 WP_003725429.1.74823 WP_003725429.1.74837 WP_003725429.1.74927 WP_003725429.1.74956 WP_003725429.1.75019 WP_003725429.1.7504 WP_003725429.1.75069 WP_003725429.1.75072 WP_003725429.1.75196 WP_003725429.1.75216 WP_003725429.1.7528 WP_003725429.1.7553 WP_003725429.1.75548 WP_003725429.1.75604 WP_003725429.1.7565 WP_003725429.1.75838 WP_003725429.1.75869 WP_003725429.1.75923 WP_003725429.1.76094 WP_003725429.1.76124 WP_003725429.1.76168 WP_003725429.1.76247 WP_003725429.1.76254 WP_003725429.1.76367 WP_003725429.1.76545 WP_003725429.1.76608 WP_003725429.1.76769 WP_003725429.1.76926 WP_003725429.1.76982 WP_003725429.1.77116 WP_003725429.1.77149 WP_003725429.1.7718 WP_003725429.1.77191 WP_003725429.1.77222 WP_003725429.1.77246 WP_003725429.1.77261 WP_003725429.1.77345 WP_003725429.1.7736 WP_003725429.1.7738 WP_003725429.1.77389 WP_003725429.1.77594 WP_003725429.1.77675 WP_003725429.1.77697 WP_003725429.1.77849 WP_003725429.1.77928 WP_003725429.1.77943 WP_003725429.1.78088 WP_003725429.1.78121 WP_003725429.1.78130 WP_003725429.1.78203 WP_003725429.1.78315 WP_003725429.1.78328 WP_003725429.1.78525 WP_003725429.1.78681 WP_003725429.1.78717 WP_003725429.1.79128 WP_003725429.1.79149 WP_003725429.1.79259 WP_003725429.1.79295 WP_003725429.1.79602 WP_003725429.1.79803 WP_003725429.1.79821 WP_003725429.1.79962 WP_003725429.1.80088 WP_003725429.1.80514 WP_003725429.1.80693 WP_003725429.1.80790 WP_003725429.1.80968 WP_003725429.1.81140 WP_003725429.1.81270 WP_003725429.1.81315 WP_003725429.1.81476 WP_003725429.1.81495 WP_003725429.1.81503 WP_003725429.1.8151 WP_003725429.1.81647 WP_003725429.1.81693 WP_003725429.1.81725 WP_003725429.1.81833 WP_003725429.1.81863 WP_003725429.1.82294 WP_003725429.1.82372 WP_003725429.1.82480 WP_003725429.1.82605 WP_003725429.1.82616 WP_003725429.1.82662 WP_003725429.1.82719 WP_003725429.1.82974 WP_003725429.1.83015 WP_003725429.1.83130 WP_003725429.1.83217 WP_003725429.1.83236 WP_003725429.1.83323 WP_003725429.1.83542 WP_003725429.1.83755 WP_003725429.1.83809 WP_003725429.1.83877 WP_003725429.1.83907 WP_003725429.1.8391 WP_003725429.1.84180 WP_003725429.1.84586 WP_003725429.1.8465 WP_003725429.1.84895 WP_003725429.1.84974 WP_003725429.1.85036 WP_003725429.1.85172 WP_003725429.1.85194 WP_003725429.1.85317 WP_003725429.1.85321 WP_003725429.1.8539 WP_003725429.1.85576 WP_003725429.1.85690 WP_003725429.1.85887 WP_003725429.1.85890 WP_003725429.1.86056 WP_003725429.1.86098 WP_003725429.1.86232 WP_003725429.1.86279 WP_003725429.1.86571 WP_003725429.1.86683 WP_003725429.1.86752 WP_003725429.1.87085 WP_003725429.1.87101 WP_003725429.1.87108 WP_003725429.1.8715 WP_003725429.1.87179 WP_003725429.1.87294 WP_003725429.1.87328 WP_003725429.1.87329 WP_003725429.1.87436 WP_003725429.1.87537 WP_003725429.1.87890 WP_003725429.1.87903 WP_003725429.1.88015 WP_003725429.1.88055 WP_003725429.1.88112 WP_003725429.1.88128 WP_003725429.1.88211 WP_003725429.1.88397 WP_003725429.1.88422 WP_003725429.1.88463 WP_003725429.1.88584 WP_003725429.1.88639 WP_003725429.1.88768 WP_003725429.1.88783 WP_003725429.1.88800 WP_003725429.1.88806 WP_003725429.1.88877 WP_003725429.1.88895 WP_003725429.1.88974 WP_003725429.1.89014 WP_003725429.1.89085 WP_003725429.1.89127 WP_003725429.1.89160 WP_003725429.1.89267 WP_003725429.1.89302 WP_003725429.1.8932 WP_003725429.1.89387 WP_003725429.1.89450 WP_003725429.1.89505 WP_003725429.1.89756 WP_003725429.1.89812 WP_003725429.1.89897 WP_003725429.1.89916 WP_003725429.1.89969 WP_003725429.1.90135 WP_003725429.1.9019 WP_003725429.1.90212 WP_003725429.1.90326 WP_003725429.1.90459 WP_003725429.1.90524 WP_003725429.1.90646 WP_003725429.1.90741 WP_003725429.1.90772 WP_003725429.1.90857 WP_003725429.1.90963 WP_003725429.1.91084 WP_003725429.1.9109 WP_003725429.1.91140 WP_003725429.1.91195 WP_003725429.1.91443 WP_003725429.1.91514 WP_003725429.1.91560 WP_003725429.1.91920 WP_003725429.1.92274 WP_003725429.1.92288 WP_003725429.1.9243 WP_003725429.1.92494 WP_003725429.1.92591 WP_003725429.1.9282 WP_003725429.1.92928 WP_003725429.1.92963 WP_003725429.1.93014 WP_003725429.1.93049 WP_003725429.1.93217 WP_003725429.1.93325 WP_003725429.1.93421 WP_003725429.1.93490 WP_003725429.1.93534 WP_003725429.1.93558 WP_003725429.1.93611 WP_003725429.1.93712 WP_003725429.1.93777 WP_003725429.1.93859 WP_003725429.1.93867 WP_003725429.1.93895 WP_003725429.1.94026 WP_003725429.1.94059 WP_003725429.1.94081 WP_003725429.1.94206 WP_003725429.1.94225 WP_003725429.1.94233 WP_003725429.1.94336 WP_003725429.1.94401 WP_003725429.1.94431 WP_003725429.1.94447 WP_003725429.1.94464 WP_003725429.1.94499 WP_003725429.1.94537 WP_003725429.1.94554 WP_003725429.1.94613 WP_003725429.1.9470 WP_003725429.1.94759 WP_003725429.1.94795 WP_003725429.1.94906 WP_003725429.1.9502 WP_003725429.1.9505 WP_003725429.1.95100 WP_003725429.1.95146 WP_003725429.1.9517 WP_003725429.1.95186 WP_003725429.1.95197 WP_003725429.1.95256 WP_003725429.1.95696 WP_003725429.1.96084 WP_003725429.1.96156 WP_003725429.1.96296 WP_003725429.1.96422 WP_003725429.1.96438 WP_003725429.1.96449 WP_003725429.1.96542 WP_003725429.1.96544 WP_003725429.1.96586 WP_003725429.1.96596 WP_003725429.1.96605 WP_003725429.1.96708 WP_003725429.1.9672 WP_003725429.1.96751 WP_003725429.1.96835 WP_003725429.1.96867 WP_003725429.1.97140 WP_003725429.1.97165 WP_003725429.1.97257 WP_003725429.1.97315 WP_003725429.1.97378 WP_003725429.1.97469 WP_003725429.1.97569 WP_003725429.1.97587 WP_003725429.1.97589 WP_003725429.1.9768 WP_003725429.1.9769 WP_003725429.1.97803 WP_003725429.1.97900 WP_003725429.1.97970 WP_003725429.1.9802 WP_003725429.1.98038 WP_003725429.1.98375 WP_003725429.1.98490 WP_003725429.1.98689 WP_003725429.1.98826 WP_003725429.1.98829 WP_003725429.1.98974 WP_003725429.1.99199 WP_003725429.1.99518 WP_003725429.1.99553 WP_003725429.1.99568 WP_003725429.1.99663 WP_003725429.1.99702 WP_003725429.1.99737 WP_003725429.1.99818 WP_003725429.1.99836 WP_003725429.1.99906 gi|404408876|ref|YP_006691591.1| gi|406705234|ref|YP_006755588.1| gi|386027828|ref|YP_005948604.1| gi|405753707|ref|YP_006677172.1| gi|284802937|ref|YP_003414802.1| gi|386009216|ref|YP_005927494.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]