SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|374339416|ref|YP_005096152.1| from Marinitoga piezophila KA3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374339416|ref|YP_005096152.1|
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily AF1862-like 1.96e-23
Family Cas Cmr5-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374339416|ref|YP_005096152.1|
Sequence length 117
Comment CRISPR type III-B/RAMP module-associated protein Cmr5 [Marinitoga piezophila KA3]
Sequence
MKRENSTKLLAKKFVIQKINKKYKDDYRSLIKGLGSMIIQNGLYGTLVFLKAKNKDHHKA
VFNDIEQYLKEKGLFKGEDLLTFLENTEELSTIQEKVLEFTNWYRRYVDIFIQTGGE
Download sequence
Identical sequences A0A1L7BP60 H2J4R9
WP_014295926.1.3510 WP_014295926.1.45777 gi|374339416|ref|YP_005096152.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]