SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|374340733|ref|YP_005097469.1| from Marinitoga piezophila KA3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|374340733|ref|YP_005097469.1|
Domain Number 1 Region: 6-64
Classification Level Classification E-value
Superfamily CsrA-like 0.000000000000876
Family CsrA-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|374340733|ref|YP_005097469.1|
Sequence length 85
Comment carbon storage regulator [Marinitoga piezophila KA3]
Sequence
MKGVRDMLVLSRKIDEGITIMIDNKILKLKVLSVEGNAIKLGFDGPKDFKIYREEVYDSI
MKENISATRVEDISGLKNIFDKSKK
Download sequence
Identical sequences H2J5V2
gi|374340733|ref|YP_005097469.1| WP_014297242.1.3510 WP_014297242.1.45777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]