SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428277462|ref|YP_005559197.1| from Bacillus subtilis subsp. natto BEST195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428277462|ref|YP_005559197.1|
Domain Number 1 Region: 3-122
Classification Level Classification E-value
Superfamily YjgF-like 2.66e-82
Family YjgF/L-PSP 0.0000743
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428277462|ref|YP_005559197.1|
Sequence length 125
Comment hypothetical protein BSNT_00084 [Bacillus subtilis subsp. natto BEST195]
Sequence
MTKAVHTKHAPAAIGPYSQGIIVNNMFYSSGQIPLTPSGEMVNGDIKEQTHQVFSNLKAV
LEEAGASFETVVKATVFIADMEQFAEVNEVYGQYFDTHKPARSCVEVARLPKDALVEIEV
IALVK
Download sequence
Identical sequences A0A063XDE3 A0A0T8PYJ9 A0A132BPR8 A0A199WBC7 A0A1J5WQV3 A0A1Q9FS47 A0A1X7FQQ9 A0A285L448 A0A2A2VR17 D4G3D4 G4ENV6 I0EZD1 L8AB73 L8PNN3 M4KNP9 P37552
gi|16077116|ref|NP_387929.1| gi|449092761|ref|YP_007425252.1| 224308.BSU00480 gi|560127071|ref|YP_008828212.1| gi|428277462|ref|YP_005559197.1| gi|402774291|ref|YP_006628235.1| NP_387929.1.22788 WP_003226738.1.100042 WP_003226738.1.11088 WP_003226738.1.11231 WP_003226738.1.11257 WP_003226738.1.1140 WP_003226738.1.11581 WP_003226738.1.12644 WP_003226738.1.12759 WP_003226738.1.1358 WP_003226738.1.1365 WP_003226738.1.14761 WP_003226738.1.15902 WP_003226738.1.16291 WP_003226738.1.17079 WP_003226738.1.18944 WP_003226738.1.19261 WP_003226738.1.19287 WP_003226738.1.20099 WP_003226738.1.20502 WP_003226738.1.21045 WP_003226738.1.22408 WP_003226738.1.23108 WP_003226738.1.2546 WP_003226738.1.25531 WP_003226738.1.27155 WP_003226738.1.27372 WP_003226738.1.27612 WP_003226738.1.27660 WP_003226738.1.2914 WP_003226738.1.31028 WP_003226738.1.31100 WP_003226738.1.31260 WP_003226738.1.31786 WP_003226738.1.32001 WP_003226738.1.32025 WP_003226738.1.32219 WP_003226738.1.32420 WP_003226738.1.32693 WP_003226738.1.32861 WP_003226738.1.33083 WP_003226738.1.33285 WP_003226738.1.33846 WP_003226738.1.35833 WP_003226738.1.36189 WP_003226738.1.37074 WP_003226738.1.3747 WP_003226738.1.39562 WP_003226738.1.39605 WP_003226738.1.40859 WP_003226738.1.42368 WP_003226738.1.42762 WP_003226738.1.43852 WP_003226738.1.44140 WP_003226738.1.44184 WP_003226738.1.45019 WP_003226738.1.47157 WP_003226738.1.47672 WP_003226738.1.48147 WP_003226738.1.51783 WP_003226738.1.5262 WP_003226738.1.52847 WP_003226738.1.54596 WP_003226738.1.54948 WP_003226738.1.54949 WP_003226738.1.55792 WP_003226738.1.56274 WP_003226738.1.56411 WP_003226738.1.57156 WP_003226738.1.57184 WP_003226738.1.57201 WP_003226738.1.5726 WP_003226738.1.57513 WP_003226738.1.59841 WP_003226738.1.6139 WP_003226738.1.62713 WP_003226738.1.63795 WP_003226738.1.64557 WP_003226738.1.64889 WP_003226738.1.6517 WP_003226738.1.65188 WP_003226738.1.65223 WP_003226738.1.65841 WP_003226738.1.67028 WP_003226738.1.67974 WP_003226738.1.69439 WP_003226738.1.71361 WP_003226738.1.71402 WP_003226738.1.7159 WP_003226738.1.7186 WP_003226738.1.71916 WP_003226738.1.72516 WP_003226738.1.72999 WP_003226738.1.73612 WP_003226738.1.76814 WP_003226738.1.76977 WP_003226738.1.77994 WP_003226738.1.78686 WP_003226738.1.79046 WP_003226738.1.79288 WP_003226738.1.79712 WP_003226738.1.79987 WP_003226738.1.80591 WP_003226738.1.80832 WP_003226738.1.81116 WP_003226738.1.81747 WP_003226738.1.82722 WP_003226738.1.82789 WP_003226738.1.84183 WP_003226738.1.84434 WP_003226738.1.84556 WP_003226738.1.87192 WP_003226738.1.87300 WP_003226738.1.88042 WP_003226738.1.88382 WP_003226738.1.88591 WP_003226738.1.89000 WP_003226738.1.89821 WP_003226738.1.90368 WP_003226738.1.90830 WP_003226738.1.91060 WP_003226738.1.91133 WP_003226738.1.91225 WP_003226738.1.9164 WP_003226738.1.91723 WP_003226738.1.92915 WP_003226738.1.93420 WP_003226738.1.94199 WP_003226738.1.95009 WP_003226738.1.95211 WP_003226738.1.96043 WP_003226738.1.979 WP_003226738.1.99091 WP_003226738.1.99399 gi|470160199|ref|YP_007531974.1| gi|472328551|ref|YP_007660827.1| gi|430757315|ref|YP_007211209.1| 5y6u_A 5y6u_B 5y6u_C gi|384173708|ref|YP_005555093.1| gi|386756627|ref|YP_006229843.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]