SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428277786|ref|YP_005559521.1| from Bacillus subtilis subsp. natto BEST195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428277786|ref|YP_005559521.1|
Domain Number 1 Region: 4-184
Classification Level Classification E-value
Superfamily SIS domain 7.08e-41
Family mono-SIS domain 0.0000000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428277786|ref|YP_005559521.1|
Sequence length 185
Comment 6-phospho 3-hexuloisomerase [Bacillus subtilis subsp. natto BEST195]
Sequence
MKTTEYVAEILNELHNSAAYISNEEADQLADHILSSHQIFTAGAGRSGLMAKSFAMRLMH
MGFNAHIVGEILTPPLAEGDLVIIGSGSGETKSLIHTAAKAKSLHGIVAALTINPESSVG
KQADLIIRMPGSPKDPSNGSYKTIQPMGSLFEQTLLLFYDAVILKLMEKKGLDSETMFTH
HANLE
Download sequence
Identical sequences A0A1Y0WLA8 A0A2J6E0P3 D4G512
WP_014478803.1.11581 WP_014478803.1.25531 WP_014478803.1.27612 WP_014478803.1.31786 WP_014478803.1.33285 WP_014478803.1.47672 WP_014478803.1.51783 WP_014478803.1.52847 WP_014478803.1.55792 WP_014478803.1.67028 WP_014478803.1.79046 WP_014478803.1.79288 WP_014478803.1.84434 gi|428277786|ref|YP_005559521.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]