SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428279735|ref|YP_005561470.1| from Bacillus subtilis subsp. natto BEST195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428279735|ref|YP_005561470.1|
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily YjgF-like 4.99e-50
Family Chorismate mutase 0.00000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428279735|ref|YP_005561470.1|
Sequence length 127
Comment chorismate mutase [Bacillus subtilis subsp. natto BEST195]
Sequence
MMIRGIRGATTVERDTEEEILQKTKQLLEKIIEENHTKPEDVVQMLLSATPDLHAVFPAK
AVRELSGWQYVPVTCMQEMDVTGGLKKCIRVMMTVQTDVPQDQIRHVYLEKAVVLRPDLS
LTKNTEL
Download sequence
Identical sequences A0A0C3KQU7 A0A125UJB1 A0A1X7FM22 A0A1Y0WRP8 A0A285L511 A8HTZ2
gi|470162472|ref|YP_007534247.1| 1com_A 1com_B 1com_C 1com_D 1com_E 1com_F 1com_G 1com_H 1com_I 1com_J 1com_K 1com_L 1dbf_A 1dbf_B 1dbf_C 2chs_A 2chs_B 2chs_C 2chs_D 2chs_E 2chs_F 2chs_G 2chs_H 2chs_I 2chs_J 2chs_K 2chs_L 2cht_A 2cht_B 2cht_C 2cht_D 2cht_E 2cht_F 2cht_G 2cht_H 2cht_I 2cht_J 2cht_K 2cht_L 3zo8_A 3zo8_B 3zo8_C 3zo8_D 3zo8_E 3zo8_F gi|430758450|ref|YP_007209196.1| cath|current|1comA00/2-115 cath|current|1comB00/2-119 cath|current|1comC00/2-120 cath|current|1comD00/2-115 cath|current|1comE00/2-119 cath|current|1comF00/2-118 cath|current|1comG00/2-115 cath|current|1comH00/2-115 cath|current|1comI00/2-115 cath|current|1comJ00/2-115 cath|current|1comK00/2-117 cath|current|1comL00/2-115 cath|current|1dbfA00/1-127 cath|current|1dbfB00/1-127 cath|current|1dbfC00/1-127 cath|current|2chsA00/2-115 cath|current|2chsB00/2-115 cath|current|2chsC00/2-115 cath|current|2chsD00/2-115 cath|current|2chsE00/2-115 cath|current|2chsF00/2-115 cath|current|2chsG00/2-115 cath|current|2chsH00/2-115 cath|current|2chsI00/2-115 cath|current|2chsJ00/2-115 cath|current|2chsK00/2-115 cath|current|2chsL00/2-115 cath|current|2chtA00/2-115 cath|current|2chtB00/2-118 cath|current|2chtC00/2-119 cath|current|2chtD00/2-115 cath|current|2chtE00/2-118 cath|current|2chtF00/2-119 cath|current|2chtG00/2-116 cath|current|2chtH00/2-117 cath|current|2chtI00/2-115 cath|current|2chtJ00/2-118 cath|current|2chtK00/2-118 cath|current|2chtL00/2-115 cath|current|3zo8A00/1-117 cath|current|3zo8B00/1-117 cath|current|3zo8C00/1-117 cath|current|3zo8D00/1-117 cath|current|3zo8E00/1-117 cath|current|3zo8F00/1-117 d1dbfa_ d1dbfb_ d1dbfc_ 1dbfA gi|428279735|ref|YP_005561470.1| gi|384175876|ref|YP_005557261.1| WP_004398675.1.101301 WP_004398675.1.11088 WP_004398675.1.11231 WP_004398675.1.11581 WP_004398675.1.12644 WP_004398675.1.12759 WP_004398675.1.1358 WP_004398675.1.15902 WP_004398675.1.18944 WP_004398675.1.19261 WP_004398675.1.20099 WP_004398675.1.21045 WP_004398675.1.23108 WP_004398675.1.2546 WP_004398675.1.25531 WP_004398675.1.27372 WP_004398675.1.27612 WP_004398675.1.27660 WP_004398675.1.31028 WP_004398675.1.31100 WP_004398675.1.31786 WP_004398675.1.32025 WP_004398675.1.32420 WP_004398675.1.32693 WP_004398675.1.33285 WP_004398675.1.34621 WP_004398675.1.35833 WP_004398675.1.39562 WP_004398675.1.40859 WP_004398675.1.42762 WP_004398675.1.43852 WP_004398675.1.44140 WP_004398675.1.47672 WP_004398675.1.51783 WP_004398675.1.5262 WP_004398675.1.52847 WP_004398675.1.52860 WP_004398675.1.54596 WP_004398675.1.54948 WP_004398675.1.55792 WP_004398675.1.56274 WP_004398675.1.56411 WP_004398675.1.57156 WP_004398675.1.57184 WP_004398675.1.5726 WP_004398675.1.64889 WP_004398675.1.65188 WP_004398675.1.67028 WP_004398675.1.69439 WP_004398675.1.71402 WP_004398675.1.7159 WP_004398675.1.7186 WP_004398675.1.71916 WP_004398675.1.72152 WP_004398675.1.72516 WP_004398675.1.76814 WP_004398675.1.76977 WP_004398675.1.78686 WP_004398675.1.79046 WP_004398675.1.79288 WP_004398675.1.79712 WP_004398675.1.79987 WP_004398675.1.80832 WP_004398675.1.84183 WP_004398675.1.84434 WP_004398675.1.84556 WP_004398675.1.87300 WP_004398675.1.88042 WP_004398675.1.88591 WP_004398675.1.89000 WP_004398675.1.89821 WP_004398675.1.90830 WP_004398675.1.91060 WP_004398675.1.9164 WP_004398675.1.92915 WP_004398675.1.93420 WP_004398675.1.94199 WP_004398675.1.95009 WP_004398675.1.95211 WP_004398675.1.99399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]