SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428280626|ref|YP_005562361.1| from Bacillus subtilis subsp. natto BEST195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428280626|ref|YP_005562361.1|
Domain Number 1 Region: 5-447
Classification Level Classification E-value
Superfamily SIS domain 1.8e-142
Family Phosphoglucose isomerase, PGI 0.0000000000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428280626|ref|YP_005562361.1|
Sequence length 450
Comment glucose-6-phosphate isomerase [Bacillus subtilis subsp. natto BEST195]
Sequence
MTHVRFDYSKALTFFNEHELTYLRDFVKTAHHNIHEKTGAGSDFLGWVDLPEHYDKEEFA
RIKKSAEKIKSDSDVLLVVGIGGSYLGARAAIEALNHAFYNTLPKAKRGNPQVIFIGNNI
SSSYMRDVMDLLEDVDFSINVISKSGTTTEPAIAFRIFRKLLEEKYGKEEAKARIYATTD
KERGALKTLSNEEGFESFVIPDDVGGRYSVLTAVGLLPIAVSGVNIDDMMKGALDASKDF
ATSELEDNPAYQYAVVRNVLYNKGKTIEMLINYEPALQYFAEWWKQLFGESEGKDEKGIY
PSSANYSTDLHSLGQYVQEGRRDLFETVLNVEKPKHELTIEEADNDLDGLNYLAGKTVDF
VNKKAFQGTMLAHTDGNVPNLIVNIPELNAYTFGYLVYFFEKACAMSGYLLGVNPFDQPG
VEAYKVNMFALLGKPGFEEKKAELEKRLED
Download sequence
Identical sequences A0A063X6V5 A0A0T8PV83 A0A125ULY6 A0A199WEW5 A0A1J5WRG5 A0A1X7CWD2 A0A1Y0WX71 A0A285JQ11 P80860 U1YPZ9
gi|402777293|ref|YP_006631237.1| gi|255767713|ref|NP_391013.2| gi|430757739|ref|YP_007208360.1| NP_391013.2.22788 WP_003243401.1.100042 WP_003243401.1.101301 WP_003243401.1.11088 WP_003243401.1.11231 WP_003243401.1.11257 WP_003243401.1.1140 WP_003243401.1.11581 WP_003243401.1.12759 WP_003243401.1.14761 WP_003243401.1.15902 WP_003243401.1.16291 WP_003243401.1.18944 WP_003243401.1.19261 WP_003243401.1.20099 WP_003243401.1.20502 WP_003243401.1.21045 WP_003243401.1.22408 WP_003243401.1.23108 WP_003243401.1.2546 WP_003243401.1.25531 WP_003243401.1.27155 WP_003243401.1.27372 WP_003243401.1.27612 WP_003243401.1.27660 WP_003243401.1.31028 WP_003243401.1.31100 WP_003243401.1.31260 WP_003243401.1.31786 WP_003243401.1.32025 WP_003243401.1.32219 WP_003243401.1.32420 WP_003243401.1.32693 WP_003243401.1.32861 WP_003243401.1.33083 WP_003243401.1.33285 WP_003243401.1.33846 WP_003243401.1.34621 WP_003243401.1.35833 WP_003243401.1.36189 WP_003243401.1.37074 WP_003243401.1.3747 WP_003243401.1.39562 WP_003243401.1.40859 WP_003243401.1.42762 WP_003243401.1.43852 WP_003243401.1.44140 WP_003243401.1.44184 WP_003243401.1.45019 WP_003243401.1.47157 WP_003243401.1.47672 WP_003243401.1.51783 WP_003243401.1.5262 WP_003243401.1.52847 WP_003243401.1.52860 WP_003243401.1.54948 WP_003243401.1.54949 WP_003243401.1.55792 WP_003243401.1.56274 WP_003243401.1.56411 WP_003243401.1.57156 WP_003243401.1.57184 WP_003243401.1.57201 WP_003243401.1.5726 WP_003243401.1.6139 WP_003243401.1.62713 WP_003243401.1.63795 WP_003243401.1.64889 WP_003243401.1.65188 WP_003243401.1.65223 WP_003243401.1.65841 WP_003243401.1.67028 WP_003243401.1.71402 WP_003243401.1.7186 WP_003243401.1.71916 WP_003243401.1.72152 WP_003243401.1.72516 WP_003243401.1.72999 WP_003243401.1.74782 WP_003243401.1.76814 WP_003243401.1.76977 WP_003243401.1.77994 WP_003243401.1.78686 WP_003243401.1.78811 WP_003243401.1.79046 WP_003243401.1.79288 WP_003243401.1.79712 WP_003243401.1.79987 WP_003243401.1.80832 WP_003243401.1.81116 WP_003243401.1.81747 WP_003243401.1.82789 WP_003243401.1.84183 WP_003243401.1.84434 WP_003243401.1.87192 WP_003243401.1.88042 WP_003243401.1.88382 WP_003243401.1.88591 WP_003243401.1.89000 WP_003243401.1.89821 WP_003243401.1.91133 WP_003243401.1.9164 WP_003243401.1.91723 WP_003243401.1.92915 WP_003243401.1.93073 WP_003243401.1.94199 WP_003243401.1.95009 WP_003243401.1.95211 WP_003243401.1.96043 WP_003243401.1.97264 WP_003243401.1.979 WP_003243401.1.99091 WP_003243401.1.99399 gi|428280626|ref|YP_005562361.1| gi|384176731|ref|YP_005558116.1| gi|470163350|ref|YP_007535125.1| gi|560130128|ref|YP_008831269.1| gi|321312678|ref|YP_004204965.1| 224308.BSU31350 gi|472331492|ref|YP_007663768.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]