SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428280774|ref|YP_005562509.1| from Bacillus subtilis subsp. natto BEST195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428280774|ref|YP_005562509.1|
Domain Number 1 Region: 15-328
Classification Level Classification E-value
Superfamily SIS domain 1.02e-58
Family double-SIS domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428280774|ref|YP_005562509.1|
Sequence length 328
Comment hypothetical protein BSNT_04832 [Bacillus subtilis subsp. natto BEST195]
Sequence
MSQATAKVNREVQAFLQDLKGKTIDHVFFVACGGSSAIMYPSKYVFDRESKSINSDLYSA
NEFIQRNPVQLGEKSLVILCSHSGNTPETVKAAAFARGKGALTIAMTFKPESPLAQEAQY
VAQYDWGDEALAINTNYGVLYQIVFGTLQVLENNTKFEQAIEGLDQLQAVYEKALKQEAD
NAKQFAKAHEKESIIYTMASGANYGVAYSYSICILMEMQWIHSHAIHAGEYFHGPFEIID
ESVPFIILLGLDETRPLEERALTFSKKYGKKLTVLDAASYDFTAIDDSVKGYLSPLVLNR
VLRSYADELAEARNHPLSHRRYMWKVEY
Download sequence
Identical sequences gi|428280774|ref|YP_005562509.1| WP_014480782.1.33285 WP_014480782.1.47672 WP_014480782.1.51783 WP_014480782.1.52847 WP_014480782.1.55792 WP_014480782.1.67028 WP_014480782.1.84434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]