SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|538263016|gb|AGU94217.1| from Vibrio campbellii ATCC BAA-1116

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|538263016|gb|AGU94217.1|
Domain Number - Region: 158-225
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.000769
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|538263016|gb|AGU94217.1|
Sequence length 261
Comment membrane protein
Sequence
MEMIEPTMLLVLALVAFVAGFIDAVAGGGGMLTVPALLSLGLPPHIALGTNKLAASFASS
TAAFTYYRKRLFKPQCWGRAFLATLIGATLGTLFVDAISTEWLEKVLPLIILAAAMYTVF
HKTPQSTHQSPTPEPCPMLNKKQYAQGFTIGFYDGLAGPGTGAFWTVSSMALYRLNILLA
SGLAKAMNFTSNFTSLITFAVLGHINWVLGLTMGVCLMAGAFIGAHSAIRFGSKFIRPVF
VTVVSVLAIKLAYDAWFVGLA
Download sequence
Identical sequences A7N1M3
gi|538263016|gb|AGU94217.1| 338187.VIBHAR_01556 gi|156973846|ref|YP_001444753.1| WP_012127414.1.100291 WP_012127414.1.11576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]