SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|538263162|gb|AGU94363.1| from Vibrio campbellii ATCC BAA-1116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|538263162|gb|AGU94363.1|
Domain Number 1 Region: 113-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000129
Family NfeD domain-like 0.0049
Further Details:      
 
Weak hits

Sequence:  gi|538263162|gb|AGU94363.1|
Domain Number - Region: 26-84
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00119
Family Glycerol-3-phosphate transporter 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|538263162|gb|AGU94363.1|
Sequence length 153
Comment regulatory protein
Sequence
MDLFSLLEGVTFWHWIAFGLALLAVELLGTAGYFLWLGLSALIVGAILSFLPISWQMQWL
AFAAFSLVTTWLWWRKQWSKDRKSDKARDLNQKHKQLIGNIVTLKEDFTVGMNRLRVADT
TWSAESEHDLPAGTRVEIVAVEGIILKIKPVSR
Download sequence
Identical sequences A7MT58
gi|156973613|ref|YP_001444520.1| gi|538263162|gb|AGU94363.1| WP_012127241.1.100291 WP_012127241.1.11576 338187.VIBHAR_01316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]