SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|538263901|gb|AGU95102.1| from Vibrio campbellii ATCC BAA-1116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|538263901|gb|AGU95102.1|
Domain Number 1 Region: 5-455
Classification Level Classification E-value
Superfamily L-aspartase-like 1.27e-134
Family L-aspartase/fumarase 0.00000000345
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|538263901|gb|AGU95102.1|
Sequence length 461
Comment fumarate hydratase
Sequence
MTTEFRIEADSMGEVKVPANALYQAQTQRAVDNFAFSKHTMPTGVIQALAHIKQTAALTN
AQLGLLEGDVANAIADAAQAIIDGKHFDQFPIDVFQTGSGTSSNMNANEVIATLASEHLG
GMVNPNDHVNMGQSSNDVVPTAIQVSSAIAIEKQLLPALSHLSETLETKQQALKDAVKTG
RTHLMDAMPITFTQELGGWQFQIEHAKQAIEQTLPAVKALAQGGTAVGTGINADPRFADL
FADNLTQSTRIEFASSKNFFFNLSSQDAIVALSGQLKTAAVAIMKIANDLRWMNSGPLAG
LGEIELQGLQPGSSIMPGKVNPVIPEAAAMASAQVIGNDSTITVAGQSGNFQLNVMLPVI
AHNVLESIELLSNSAVALADKAIATFEVRQDNLDVALAKNPILVTALNPVIGYLKAAEVA
KKAYKQGRAIIDVAEEETDLDRATLERLLDPAKLTQGGVAE
Download sequence
Identical sequences A7MXI7
338187.VIBHAR_00163 WP_012126513.1.100291 WP_012126513.1.11576 gi|156972531|ref|YP_001443438.1| gi|538263901|gb|AGU95102.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]