SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|538263997|gb|AGU95198.1| from Vibrio campbellii ATCC BAA-1116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|538263997|gb|AGU95198.1|
Domain Number 1 Region: 3-456
Classification Level Classification E-value
Superfamily L-aspartase-like 4.08e-140
Family L-aspartase/fumarase 0.00000000000591
Further Details:      
 
Domain Number 2 Region: 466-584
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000000157
Family N-acetyl transferase, NAT 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|538263997|gb|AGU95198.1|
Sequence length 624
Comment bifunctional argininosuccinate lyase/N-acetylglutamate synthase
Sequence
MALWGGRFTQAADTRFKDFNDSLRFDYRLAEQDIVGSIAWSKALLSVDVLSAEEQQKLEL
ALNELKLEVMEDPHQILRSDAEDIHSWVEQQLINKVGDLGKKLHTGRSRNDQVATDLKLW
CRQQGQQLLIALDRLQTQMVGVAKQHQGTVLPGYTHLQRAQPVTFAHWCLAYVEMFERDY
SRLSDALKRLDTCPLGSGALAGTAYPIDREELAHNLGFHRATRNSLDSVSDRDHVMELMS
VASISMLHLSRLAEDMIFYNSGESNFIELADTVTSGSSLMPQKKNPDALELIRGKTGRVY
GALAGMMMTVKALPLAYNKDMQEDKEGLFDALDTWNDCMEMAALCFDGIKVNGERTLEAA
KQGYANSTELADYLVAKGIPFREAHHIVGVAVVGAIAKGCALEELSIDELKAFSEVIEAD
VYDILTIDSCLEKRCALGGVSPQQVASAVDQADKRLFQRDTSAVNVRPARLTDIKTLEGM
VAYWANMGENLPRSRNELVRDIGSFAVAEHHGEVTGCASLYVYDSGLAEIRSLGIEAGWQ
GQGQGSAIVNYLVEKARQMAIKKVFVLTRTPEFFMKQSFLPTSKSLLPEKVLKDCDQCPR
QHACDEVALEINLFEQLIQKSNVA
Download sequence
Identical sequences A7MXB8
gi|538263997|gb|AGU95198.1| 338187.VIBHAR_00040 WP_012126441.1.100291 WP_012126441.1.11576 gi|156972420|ref|YP_001443327.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]