SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|538264250|gb|AGU95451.1| from Vibrio campbellii ATCC BAA-1116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|538264250|gb|AGU95451.1|
Domain Number 1 Region: 5-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.1e-48
Family Ribonuclease PH domain 1-like 0.0000171
Further Details:      
 
Domain Number 2 Region: 299-493
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.85e-46
Family Ribonuclease PH domain 1-like 0.0000197
Further Details:      
 
Domain Number 3 Region: 146-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.02e-28
Family Ribonuclease PH domain 2-like 0.00093
Further Details:      
 
Domain Number 4 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 9.68e-28
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 5 Region: 608-695
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.17e-21
Family Cold shock DNA-binding domain-like 0.0000702
Further Details:      
 
Domain Number 6 Region: 240-321
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.66e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0033
Further Details:      
 
Domain Number 7 Region: 553-630
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000106
Family Eukaryotic type KH-domain (KH-domain type I) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|538264250|gb|AGU95451.1|
Sequence length 710
Comment polynucleotide phosphorylase/polyadenylase
Sequence
MFEKPVVKTFQYGNHTVTLETGVIARQATAAVMVTMDDTAVFVSVVGKKEAVEGQDFFPL
TVNYQERTYAAGKIPGGFFKREGRPSEGETLTARLIDRPIRPLFPDAFKNEVQVIATVVS
VNPDVQPDIPTMIGTSAALAISGIPFNGPIGAARVGHIDGQLVLNPSNTELEASKLDLVV
AGTESAVLMVESEADNLTEEEMLSAVVFGHDQQQAVIKAINEFKAEVATPAWDWVAPAEN
TALVTKIAELAEAKLVEAYQITEKMARYDRIHEIAGEVNEVLLAEDPEANTKEIHTIFHD
LEKTVVRRSIIAGNPRIDGREKDMVRALDVRTGVLPRTHGSSLFTRGETQALVTATLGTQ
RDAQIIDELTGERKDHFLLHYNFPPYCVGETGFVGSPKRREIGHGKLAKRGIAAVMPSVD
EFPYTVRVVSEITESNGSSSMASVCGTSLALMDAGVPIKSSVAGIAMGLVKEGDDFVVLS
DILGDEDHLGDMDFKVAGTNTGITALQMDIKIEGITKEIMQIALNQAQGARKHILSVMDE
AISGAREDISEFAPRIHTMKISAEKIKDVIGKGGAVIRALTEETGTTIEIEDDGTIKIAA
TEGAAAKEAIRRIEEITAEVEVGRIYTGKVARLADFGAFVTVLPGKDGLVHISQIAEKRV
EKVSDYLTEGQEVQVKVLEIDRQGRVRLSMKEAVEKPAEEANDASEAKGE
Download sequence
Identical sequences A7MZI2
gi|156975660|ref|YP_001446567.1| 338187.VIBHAR_03393 WP_012128820.1.100291 WP_012128820.1.11576 WP_012128820.1.16230 WP_012128820.1.2281 WP_012128820.1.90381 WP_012128820.1.92229 gi|538264250|gb|AGU95451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]