SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|538264361|gb|AGU95562.1| from Vibrio campbellii ATCC BAA-1116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|538264361|gb|AGU95562.1|
Domain Number 1 Region: 13-243
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.5e-59
Family PP-loop ATPase 0.00000195
Further Details:      
 
Domain Number 2 Region: 332-446
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.18e-27
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.00075
Further Details:      
 
Domain Number 3 Region: 249-329
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 4.84e-24
Family MesJ substrate recognition domain-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|538264361|gb|AGU95562.1|
Sequence length 448
Comment tRNA(Ile)-lysidine synthetase
Sequence
MESLYSQFAQVLERYYQSGTKIVLAFSGGVDSRLLLELLSRYQKAYSVDNQSTDSHSFKC
HAVYVHHGLSSNADEWAGKCLVWAEQAGITCSVERVSLDTNSGESIELLAREARYQALAK
HIQSGDLLLTGQHADDQVETFLLALKRGSGPKGLSSMAESMPFAGGTLVRPLLAIKREQI
EAVAKEQGLDWVEDESNQDTRYDRNFLRHRIMPELSERWPSIHQAVQRSASLCAQQEALL
DELLLAVFERALQSDFSLSIEELATHSELARARLVRMWLAKLNANMPTQVQLNLIWNEVA
LAQQDANPKLQLKQGEVRRFQNRLYWVTETVDVTTWQSAIQTDTALLLPEQLGELTLSTN
SEQATIAMPPHPELLRVTFNPEGLSAHPTTRSHSRKLKKLFQEYNVPSWLRRQIPILMYQ
DKVVAVGNLFVDQAFSGQDCELIWRKSL
Download sequence
Identical sequences A7MXZ8
338187.VIBHAR_03220 gi|156975489|ref|YP_001446396.1| WP_012128686.1.100291 WP_012128686.1.11576 gi|538264361|gb|AGU95562.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]