SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|538265024|gb|AGU96225.1| from Vibrio campbellii ATCC BAA-1116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|538265024|gb|AGU96225.1|
Domain Number 1 Region: 4-448
Classification Level Classification E-value
Superfamily L-aspartase-like 5.5e-109
Family L-aspartase/fumarase 0.0000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|538265024|gb|AGU96225.1|
Sequence length 456
Comment adenylosuccinate lyase
Sequence
MELSALTAVSPVDGRYGSKTIALREIFSEYGLLKYRTIVEIRWLQKLAATAEIAEVPAFS
AEANQFLDDLAANFSEEDARRIKEIERTTNHDVKAVEYFLKEKVADVPELHAVNEFFHFA
CTSEDINNTSHALMLKEARENVILPEIRNLIDAIKALAVEYRDIPLLSRTHGQPASPSTM
GKEMANVAYRMERQFKQIENVEILAKINGAVGNYNAHLSAYPELDWHKFSEEFITESLGV
TWNPYTTQIEPHDYIAELFDAIARFNTILIDFDRDVWGYIALGHFKQKTIAGEIGSSTMP
HKVNPIDFENSEGNLGLANAVFGHLAQKLPISRWQRDLTDSTVLRNLGVGVGYAIIAYTS
TLKGISKLEVNREALLAELDKNWEVLAEPVQTVMRRYGIEKPYEKLKELTRGKRVDGEAM
RNFIDGLELPEHEKARLKEMTPANYIGQAIELTDKL
Download sequence
Identical sequences A0A061PJH9 A0A061Q0W4 A0A0A3EQ20 A0A0C1YNP7 A0A0C1YZ79 A0A0H0YJF2 A0A1E3DLM0 A0A2I3BYW3 K5U0M4 K5UVU9 K5VBP5 L8XMA6
WP_005378198.1.100070 WP_005378198.1.100291 WP_005378198.1.101244 WP_005378198.1.11263 WP_005378198.1.11576 WP_005378198.1.11784 WP_005378198.1.12359 WP_005378198.1.14974 WP_005378198.1.1499 WP_005378198.1.15699 WP_005378198.1.16148 WP_005378198.1.16230 WP_005378198.1.18029 WP_005378198.1.18167 WP_005378198.1.18388 WP_005378198.1.18807 WP_005378198.1.19947 WP_005378198.1.20786 WP_005378198.1.23210 WP_005378198.1.24139 WP_005378198.1.25047 WP_005378198.1.25554 WP_005378198.1.26610 WP_005378198.1.27229 WP_005378198.1.29144 WP_005378198.1.30734 WP_005378198.1.31008 WP_005378198.1.32528 WP_005378198.1.33421 WP_005378198.1.34412 WP_005378198.1.37650 WP_005378198.1.40020 WP_005378198.1.41816 WP_005378198.1.43162 WP_005378198.1.43523 WP_005378198.1.43967 WP_005378198.1.4511 WP_005378198.1.45469 WP_005378198.1.4555 WP_005378198.1.4651 WP_005378198.1.47200 WP_005378198.1.48501 WP_005378198.1.49504 WP_005378198.1.49791 WP_005378198.1.50503 WP_005378198.1.51142 WP_005378198.1.51667 WP_005378198.1.52961 WP_005378198.1.53497 WP_005378198.1.54915 WP_005378198.1.5530 WP_005378198.1.55333 WP_005378198.1.56715 WP_005378198.1.58614 WP_005378198.1.5980 WP_005378198.1.59902 WP_005378198.1.6150 WP_005378198.1.61813 WP_005378198.1.61993 WP_005378198.1.63946 WP_005378198.1.64178 WP_005378198.1.64533 WP_005378198.1.65646 WP_005378198.1.66627 WP_005378198.1.68195 WP_005378198.1.70465 WP_005378198.1.70945 WP_005378198.1.72011 WP_005378198.1.74002 WP_005378198.1.7709 WP_005378198.1.77537 WP_005378198.1.81646 WP_005378198.1.82060 WP_005378198.1.82938 WP_005378198.1.83275 WP_005378198.1.84855 WP_005378198.1.86147 WP_005378198.1.86697 WP_005378198.1.86758 WP_005378198.1.88573 WP_005378198.1.91833 WP_005378198.1.92229 WP_005378198.1.93958 WP_005378198.1.96035 WP_005378198.1.97071 WP_005378198.1.99004 WP_005378198.1.99820 gi|538265024|gb|AGU96225.1| gi|543942092|ref|YP_008534548.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]