SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|538266281|gb|AGU97481.1| from Vibrio campbellii ATCC BAA-1116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|538266281|gb|AGU97481.1|
Domain Number 1 Region: 4-175
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 3.61e-36
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|538266281|gb|AGU97481.1|
Sequence length 179
Comment cytochrome B561
Sequence
METLVKNYNLPARFMHWLSALCIIGLFAVGLWMVDLSYYSEWYRTAPHYHRSVGILLATL
TLARIVWKHVTASPKVEGKPYEVVAAKAAHGVMYLLLITIFISGYLISTSDGRGIEVFNW
FTVPGAGELFPSQSDIAGEIHFYAAWAVILMAGLHAAAALKHHFIDKDNTLRKMLGASK
Download sequence
Identical sequences A7N8H6 L8XJR5
gi|538266281|gb|AGU97481.1| gi|156977139|ref|YP_001448045.1| 338187.VIBHAR_05925 WP_005530836.1.100291 WP_005530836.1.11576 WP_005530836.1.20786 WP_005530836.1.30734 WP_005530836.1.61813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]