SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|538267040|gb|AGU98240.1| from Vibrio campbellii ATCC BAA-1116

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|538267040|gb|AGU98240.1|
Domain Number - Region: 6-49
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.00204
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|538267040|gb|AGU98240.1|
Sequence length 61
Comment hypothetical protein M892_18745
Sequence
MLLKSKGVQTWARRLHIYISMALLLVTLFFALTGITLNRPELFERSEPIIQQHTLNIPNV
G
Download sequence
Identical sequences WP_021018087.1.100291 WP_021018087.1.11576 gi|538267040|gb|AGU98240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]