SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|538262532|gb|AGU93733.1| from Vibrio campbellii ATCC BAA-1116

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|538262532|gb|AGU93733.1|
Domain Number 1 Region: 27-528
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.81e-115
Family Pyridoxal-dependent decarboxylase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|538262532|gb|AGU93733.1|
Sequence length 548
Comment glutamate decarboxylase
Sequence
MVKEQKTADVSFESLLKIFTIPEGPDSTLTKIDESLSQNLNQFLREHIVAEEKPLHEIEK
DFSSAQIPEQPEFVSDHTEHLLDTLVSHSVHTSAPSFIGHMTSALPYFLMPLSKIMIALN
QNLVKIETSKAFTPLERQVLGMLHRLIYGQDDKFYAKWMHSAKHSLGAFCSGGTIANITA
LWVARNKALKANGAFKGVEKEGLFKAMKHYGYEGLAILVSERGHYSLKKAADVLGLGQEG
LVAVKTDANNRIIVDDLKVKIAELEAQNIKPIAVVGVAGTTETGSVDPLAQIAEVCAEHN
CHFHVDAAWGGATLMSNHHRHLLDGVELADTVTIDAHKQLYIPMGAGMVLFKDPDAMKSI
EHHAQYILRKGSKDLGSHTLEGSRSGMAMLVYAAMHIISRPGYELLIDQSIAKARYFADL
INQQEDFELVSEPELCLLTYRYLPTHMRAALEKAQGTQKEKLNELLNQLTQFIQKRQRET
GKSFVSRTRLNPDQWQRMNTIVFRVVLANPLTTNDILNAVLDEQREIALQAPSLMAKIEE
TVEDILNS
Download sequence
Identical sequences gi|538262532|gb|AGU93733.1| WP_021017679.1.100291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]