SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385331536|ref|YP_005885487.1| from Marinobacter adhaerens HP15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385331536|ref|YP_005885487.1|
Domain Number 1 Region: 110-270
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.89e-46
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00039
Further Details:      
 
Domain Number 2 Region: 398-539
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.14e-38
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0013
Further Details:      
 
Domain Number 3 Region: 7-113
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 8.01e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.01
Further Details:      
 
Domain Number 4 Region: 243-267,306-412
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.49e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385331536|ref|YP_005885487.1|
Sequence length 540
Comment sulfite reductase hemoprotein, beta subunit [Marinobacter adhaerens HP15]
Sequence
MAAERVAQFRDQTERALAGELAEDEFLPLRLQNGLYVQRLAPMLRICVPYGMMRSNQLRR
LARITRDYDKGYAHFTTRQNVQLNWPALEDVPDILAELAEVEMHANQTSGNCIRNTTTDQ
FSGVQSDEIADPRPYCEIIRQWSTFHPEFAFLPRKFKVAVNASEQTDRAAIQVHDIGLQM
VRNEAGDLGFRVHVGGGLGRTPMVGPVIRDFLPELDLLTYLEAVLRVYNRYGRRDNKFKA
RIKILVKALTPEGFAEKVEAEWQHIKESPTRLTPEAIQRIQGYFTEPDYAAIDNATDLLA
SQRFENRGFDQWLTHNVDTHKKAGYAIVSLTMKKTGTPPGDVSDKQLEQIADLADEFSFG
EIRVTHQQNVVLADVRQDRLFELWQAITPMGFGTANLNTLTDVICCPGGDYCALANAKSI
PVAEAIQRQFDDLDYLYDLGNIDLNISGCMNACGHHHVGNIGVLGVDKKGQEFYQISLGG
SSHHDASIGKILGPSFARDEMPKVISKIIDVYVDKRTEEETFLDTYRRVGIDPFKERVYA
Download sequence
Identical sequences E4PNR5
gi|385331536|ref|YP_005885487.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]