SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385333621|ref|YP_005887572.1| from Marinobacter adhaerens HP15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385333621|ref|YP_005887572.1|
Domain Number 1 Region: 631-806
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.27e-52
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0022
Further Details:      
 
Domain Number 2 Region: 3-190
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.62e-38
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0034
Further Details:      
 
Domain Number 3 Region: 500-639
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.8e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.017
Further Details:      
 
Domain Number 4 Region: 148-306
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.43e-24
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385333621|ref|YP_005887572.1|
Sequence length 835
Comment nitrite reductase (NAD(P)H) large subunit [Marinobacter adhaerens HP15]
Sequence
MSKKTLIVIGNGMVGHHFLEQFCASPAAADFEIIVFGEEKQLAYDRVHLSEYFGGSTHAD
LAMGTLEWYTEQGIQLHLNEQVTGINREDRTLATPRGSYRYDELVLATGSYPFVPPIEGN
DRPHCLVYRTLDDLDAIRASSEGARAGVVVGGGLLGLEAANALKSLGLEAHVVEFAPRLM
PVQLDADGGALLRHKIEELGVQVHTEKATTAITEGEDARLRMNFSDESFLETDLIVFSAG
IRPQDALARASGLAIGERGGIVINNHCTTSDPHVHAIGECALWEQKIFGLVAPGYTMART
LSAALNGDRETAFTGADMSTKLKLLGVDVGSIGDAHAQTPGARNIRFNDEQAGHYRRMVI
SEDGKTLLGAILVGDNSHYDTLLQYALNGITLPENPETLILPESQGGAPALGPDALPETA
SICSCHNVTKGDICGAINAGCSDLGSVKAETKASTGCGGCTALLKNVVDSELEKRGVEVS
KDLCEHFPYSRQELFHLVKVNGIRTFGTLISQHGRGHGCDICKPAVASILATCWNEHILA
TDHVPLQDTNDTFMANMQKNGTYSIVPRIPGGEITPDKLIVLGEVAKEYDLYTKITGGQR
VDLFGATLSQLPEIWEKLIAAGFETGHAYGKSLRTVKSCVGNTWCRYGVQDSVGMAIRLE
DRYKGLRAPHKVKMAVSGCTRECAEAQSKDFGVIATENGWNLYVCGNGGMRPRHADLFAT
DLSDEELIRTIDRVVMFYVRTADRLQRTSVWMENLEGGLEYLKQVVLEDSLGIGAELEEH
MEGIVGTYQCEWKTAVEDPEKRKRFREFVNAPSQSDPVQEWTVERGQRRPVLESA
Download sequence
Identical sequences E4PJT4
gi|385333621|ref|YP_005887572.1| WP_014579000.1.11983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]