SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385330483|ref|YP_005884434.1| from Marinobacter adhaerens HP15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385330483|ref|YP_005884434.1|
Domain Number 1 Region: 233-277,308-334,426-631
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.44e-44
Family CoA transferase alpha subunit-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385330483|ref|YP_005884434.1|
Sequence length 736
Comment acetyl-CoA hydrolase [Marinobacter adhaerens HP15]
Sequence
MAGDRGQLSNDVNACVDEVIRRVGKEITLGLPLGLGKPVRFVNALYQRAKDDSEISLHIV
TALSLLAPKGGSSLEKRFMGPFVERLYGRIPELAYARDVSANRLPENVQVSEFFFKAGSY
LNNRSQQRHYVCTNYTHAVRDLMAVGVNVVAQMVSPGEAHGQPGQVSLSCNPDLTLDLIP
LLREREAAGTPVALVAEMNQNLPWFGHHAAIEADRFDILLDQPSGDYPLFSAPQMSVSPE
DHLIGFYASTLLKDGGTLQVGIGSLGAALVHSAILRHSHNKAWRQVFDHLQVDQHFPVVR
EDGGAGPFEEGLYGCSEMMVDGFLYLMQEGILTREVYDHAGLQTLINRGDIPSEVSLATL
DVLRREKLIDSPLRAKDVHWLVQHGIFKEAVEFKGGRLRIGDQSVEGDLDNPEARQAIET
LILGERLTGGIAMHGGFYVGPEQFYQYLREMTDEQRAKICMTSVNFINHLYDHRFGDQKL
KAAQRVHGRFINSAMMYTLNGAGVSDGLEDGRVVSGVGGQYNFVAMAHELPGARSILSLR
STRSSQGKVLSNIVFNYGHCTIPRHLRDIVITEYGIADLRGQSDEQVFLRLIRIADSRFQ
QELLKKAQKAGKVDPAFRLPADWCNNTPQAIRRAVAAAGDASLFPPFPFGRDFTDEELTL
GKALKGLKAATATRRGKLSTLLQALRARDDEGRYGSLLERMGLRNPSGLRDKLDRRLVIH
GLQQLETPPDTGNSKT
Download sequence
Identical sequences E4PQG3
WP_014576250.1.11983 gi|385330483|ref|YP_005884434.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]