SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387812617|ref|YP_005428094.1| from Marinobacter hydrocarbonoclasticus ATCC 49840

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387812617|ref|YP_005428094.1|
Domain Number 1 Region: 631-806
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.57e-52
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 3-189
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.15e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00095
Further Details:      
 
Domain Number 3 Region: 500-639
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.05e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.015
Further Details:      
 
Domain Number 4 Region: 148-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.72e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387812617|ref|YP_005428094.1|
Sequence length 837
Comment nitrite reductase, large subunit, nucleotide-binding [Marinobacter hydrocarbonoclasticus ATCC 49840]
Sequence
MSKQTLIVIGNGMVGHHFLEQFSQSPAAETYRVIVFGEEKQLAYDRVHLSEYFTGSTHAD
LAMGTADWYAEQGIDLRLNEPVTAIDRNTRVLTTPKGEYTYDQLVLATGSYPFVPPIKGN
DQDGCFVYRTLDDLDAIQASAQSAKTGVVVGGGLLGLEAANALKSLGLQAHVVEFAPRLM
PVQLDDQGGALLRQKIEDLGVQVHTEKATTAIVPGSDARLRMNFADDSHLETDLIVFSAG
IRPQDTLARACGLDVGERGGIVVNNQCTTSDPNIHAIGECALWNNRIFGLVAPGYTMART
LSAALNKDTGAAFTGADMSTKLKLLGVDVGSIGDAHGQTPGARNIRFHDEQAGHYRRMVV
SQDGKTLLGAILVGDNGPYDTLLQYALNGIELPANPEALILPESEGGAPALGADALPDTA
SICSCHNVTKGDICGAIDAGCSDLGGVKTETRASTGCGGCAALLKKVVDSELEKRGVEVC
TDLCEHFPYTRQELFHLVKVNGIRTFRGLLKQYGKGQGCDICKPTVGSILATCWNEHILA
TDHVPLQDTNDTFMANMQKNGTYSIVPRIPGGEITPDKLIVLGEVAREYNLYTKITGGQR
VDLFGATLSELPEIWEKLIAAGFETGHAYGKSLRTVKSCVGSTWCRYGVQDSVGMAITLE
NRYKGLRAPHKVKMAVSGCTRECAEAQSKDFGVIATEKGWNLYVCGNGGMRPRHADLFAT
DLSDEELIRTIDRVVMFYVRTADRLQRTSVWMENLEGGLEYLKQVVLEDSLGIGEELEQH
MADLVDTYQCEWRTAVEDPEKRKRFREFVNAPEQKDPVQRWTSERGQRRPELEAVSS
Download sequence
Identical sequences H8WBM4
gi|387812617|ref|YP_005428094.1| WP_014420147.1.95793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]