SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387813344|ref|YP_005428826.1| from Marinobacter hydrocarbonoclasticus ATCC 49840

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387813344|ref|YP_005428826.1|
Domain Number 1 Region: 233-277,308-334,427-631
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.29e-43
Family CoA transferase alpha subunit-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387813344|ref|YP_005428826.1|
Sequence length 737
Comment hypothetical protein MARHY0921 [Marinobacter hydrocarbonoclasticus ATCC 49840]
Sequence
MAAENGVYCDDAERCVDRVIERVGKRITLGLPLGLGKPVRFVNALYQRAKDDPDIELHIV
TALSLLAPEGSSSLEKRFMGPFAKRLFGDIPELAYARDVANNRLPSNVQVSEFFFKAGSY
LNNRNQQRNYVCTNYTHAVRDLMAQGVNVVGQMVSPGEPNGFPGQVSFSCNPDLSLDILP
LLREREQQGVPVAMVAEINQYLPWFGHHAAVEEQQFDLLFSHPSTDYPLFSAPQMAISPS
DHLIGFYASCLLKDGGTLQVGIGSLGASLVHNAILRHKHNDAWRAVYDHLDVGSRFPVVD
SCGGTGTFETGLYGCSEMMVDGFLYLMQEGILKREVFDHAGLQTLINRGEITLTPSLDML
DVLVREGLIDSPLRARDVNWLIQYGILRDTVEFRGGRLRLSEDHAVEADLSQDQTREALA
ALGLGSRLIGGIAMHGGFYVGPEAFYQALRDLSPEQRDKICMTSVNFINHLYDHRFGDQK
LKAAQRLHGRFINSAMMYTLNGAAVSDGLDDGRVVSGVGGQYNFVSMAHELPGARSILAL
RATRMSGGQVVSNIVFNYAHCTIPRHLRDIVITEYGIADLRGRSDEDVFLALIRIADSRF
QADLLKQAQKAGKVRDDFRLPADWQNNTPASVRQALAAPGKGDWFPAFPFGRDFTDEELT
LGKALKGLKAATATPRGKLATLWQAIRAEDDTGQYAVLLERMGLNNPSGIREKLDRKLVI
HGLQQLEPATKTGSENS
Download sequence
Identical sequences A1U332 H8W6Z6
gi|387813344|ref|YP_005428826.1| gi|120555237|ref|YP_959588.1| WP_011785788.1.7233 WP_011785788.1.95793 351348.Maqu_2325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]