SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387815872|ref|YP_005431365.1| from Marinobacter hydrocarbonoclasticus ATCC 49840

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387815872|ref|YP_005431365.1|
Domain Number 1 Region: 23-529
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.56e-107
Family Pyridoxal-dependent decarboxylase 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387815872|ref|YP_005431365.1|
Sequence length 558
Comment cysteine sulfinic acid decarboxylase (Csad) [Marinobacter hydrocarbonoclasticus ATCC 49840]
Sequence
MTGKKKSAQASLEAMYRVFTVPEAPESTLSRIDQDISRNLAGFLQEHIVAIERDLSEVEK
DFSDYVIPEKPVFVSEQTQFLLDKLVANSVHTASPAFIGHMTSALPYFMLPLSKIMIALN
QNLVKTETSKAFTPMERQVLGQIHRLVYQEDGSFYRKWMHDPRHALGAMCSGGTVANLTA
LWVARNRAFPAEGSFRGLHEEGLFRALKYYGHEGAAIVVSKRGHYSLRKAADVLGLGRDA
LVPVETDEFNRIQTDALRDKCLELQKQKIKIMAICGVAGTTETGNVDPLDAMADIAREFG
AHFHVDAAWGGPTLFSRTHKHLLRGIEKADSVTFDAHKQLYVPMGAGLVVFKDPGLASAV
EHHAQYIIRKGSRDLGSTTLEGSRPGMAMLIHSGLKILAREGYEILIDQGIDKAKTFANM
IDEQPDFELVTRPELNILTYRYCPEDVRQALAMADELQAEKMNTCLNRITKFIQKTQRER
GKAFVSRTRLEPARYYHFPCIVFRVVLANPLTTPDILEDILREQRELSKEDGIADEIGIL
HQMAAAVLKQNQKEARQA
Download sequence
Identical sequences H8W7D9
WP_014422854.1.95793 gi|387815872|ref|YP_005431365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]