SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|348026012|ref|YP_004765817.1| from Megasphaera elsdenii DSM 20460

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|348026012|ref|YP_004765817.1|
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Ribosomal protein S7 2.22e-62
Family Ribosomal protein S7 0.000000724
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|348026012|ref|YP_004765817.1|
Sequence length 156
Comment 30S ribosomal protein S7 [Megasphaera elsdenii DSM 20460]
Sequence
MPRKGPVPKRDVLPDPVYHSKLVTRFINKVMLDGKKGVAETIVYDAFDIIRSKMNKDPLE
VFEQALNNVMPVLEVRARRVGGANYQVPVEVRADRRLSLGIRWTVGYARKRGERTMKEKL
AGELMDAFNNTGAAIKKKEDTHKMAEANKAFAHYRW
Download sequence
Identical sequences A0A1M6PHU7 G0VNG2 R7MUD7 S7J3U9
WP_014015731.1.100710 WP_014015731.1.32526 WP_014015731.1.35947 WP_014015731.1.58909 WP_014015731.1.63812 WP_014015731.1.91982 WP_014015731.1.94127 WP_014015731.1.99491 gi|348026012|ref|YP_004765817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]