SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397689252|ref|YP_006526506.1| from Melioribacter roseus P3M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397689252|ref|YP_006526506.1|
Domain Number 1 Region: 13-253
Classification Level Classification E-value
Superfamily Folate-binding domain 2.67e-38
Family Aminomethyltransferase folate-binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|397689252|ref|YP_006526506.1|
Domain Number - Region: 257-330
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00213
Family Aminomethyltransferase beta-barrel domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397689252|ref|YP_006526506.1|
Sequence length 332
Comment aminomethyl transferase, glycine cleavage T protein [Melioribacter roseus P3M-2]
Sequence
MFIETEKRKMPENIKEEYNLLRYGAGAVVLEENIIKLTGKDTLDFIHRVSTNDVKGLMPG
AKIRTLFLNDKGRFVDRTIFLYITDFFWLVGQNDPDKKLLSWINKYIITEDIKTEDLTND
YKVITITGQQSASYLSLIFGQEFTSLDDKNLIVTQTSGFDTVLFRCVEKGQTFYKVIVKS
NQYNQFVEYLNANKSVFDFGFVSDEAFKYYCILHGLPGRNEITLEFNPHEVGLTDEISFT
KGCYIGQEVIARLDTYDKVQKKLIGVKIEANMPEKSYDIYNSGEFAGIITSGINVDGEFY
GLAVVKKKYLDDNPLYISYEGKEVEIAVRNFD
Download sequence
Identical sequences I6ZWQ7
WP_014854930.1.57241 gi|397689252|ref|YP_006526506.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]