SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397690000|ref|YP_006527254.1| from Melioribacter roseus P3M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397690000|ref|YP_006527254.1|
Domain Number 1 Region: 130-229,380-455
Classification Level Classification E-value
Superfamily TrmE connector domain 1.7e-48
Family TrmE connector domain 0.00073
Further Details:      
 
Domain Number 2 Region: 82-172,206-371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.43e-42
Family G proteins 0.0000819
Further Details:      
 
Weak hits

Sequence:  gi|397690000|ref|YP_006527254.1|
Domain Number - Region: 24-77
Classification Level Classification E-value
Superfamily Folate-binding domain 0.00746
Family Aminomethyltransferase folate-binding domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397690000|ref|YP_006527254.1|
Sequence length 455
Comment tRNA modification gtpase trme [Melioribacter roseus P3M-2]
Sequence
MTHTISTNEDTITAIATPPGVGAITVIRVSGPDTFSKVDLIFRGRKKISECNTHTIHYGT
IVDPNGEVIDDVLVSVFRSPNSYTGEDSVEISTHGSQLIAEKIIGLLVERGIRIAEPGEF
TKRAFLNGRLDLAQAEAVADVINSRSEASLRGARNQLDGLLSQKIDTLREKLINTSSLIE
LELDFAEEDIELLPLAKIISNIGEIEKEIDELLKSFRFGKVIRDGVNVALVGKPNVGKSS
LLNYLLKEARAIVSEIPGTTRDIIREEVTIEGILFKLYDTAGIRLTEDVIEKEGVERSRK
AVSDADVVLFLNDSTHGFDRDIYDELLKLQKEERILKVANKIDLKPGLDKSFDVGISAKT
GEGIEELFRKLKEKALGSGTYTEKSAVVTNLRHYNALNKAKEHLIGAKNSIKEGLTGEFV
AVDLRNAENSLGEIIGKVTTDDILNNIFAKFCIGK
Download sequence
Identical sequences I7A2T5
gi|397690000|ref|YP_006527254.1| WP_014855677.1.57241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]