SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397690580|ref|YP_006527834.1| from Melioribacter roseus P3M

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397690580|ref|YP_006527834.1|
Domain Number 1 Region: 36-455
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 1.57e-128
Family Class I alpha-1;2-mannosidase, catalytic domain 0.000000467
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397690580|ref|YP_006527834.1|
Sequence length 459
Comment Mannosyl-oligosaccharide 1,2-alpha-mannosidase [Melioribacter roseus P3M-2]
Sequence
MKYIINALVLCIVVILAMVSCKDGANTKQKQVINYEQYADSVIQDFKFAWEAYKKYAWGH
DALKPLTKTYHDWYGVSLLMTPVDSYDTMVLMGLNEEADEAKKLILDSLSFNKDIYVQHF
EITIRLLGGLLSAYLLDGDPKFLELATDLANRMLPVFNSPTGMPYVFVNLKTGKTKGEIN
NPAEIGTLLLEYGTLSKLTGNPIYYDKAKKAIMALMEKSSDIGLVGTLIDVNTGKWINTE
CHISGMIDSFFEYLLKTSLLFKDEEIESAWKKTITGINNFMKHKTENGLWYSHVDMFSGK
RLKTQVGALDAFFPAVLCLAGNIDDAREFNESLFSLWEKYGIIPEQYDYMNDTIISAAYY
LRPECIESAYYLYNYTKDEKYLRMGVRYYSSIVKYCKTGEAFSHLESVVTKQKEDAMESF
FFAETLKYLYLLFDQGKSLKFNDVIFNTEAHPILIEKIQ
Download sequence
Identical sequences I7A4J9
WP_014856255.1.57241 gi|397690580|ref|YP_006527834.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]