SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410694894|ref|YP_003625516.1| from Thiomonas arsenitoxydans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410694894|ref|YP_003625516.1|
Domain Number 1 Region: 120-272
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.02e-42
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 415-560
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.44e-36
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.2e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.019
Further Details:      
 
Domain Number 4 Region: 320-427
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.78e-21
Family Duplicated SiR/NiR-like domains 1 and 3 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410694894|ref|YP_003625516.1|
Sequence length 619
Comment Sulfite reductase [Thiomonas arsenitoxydans]
Sequence
MYQYTDFDRRFIRARAAQYRDQLERHLAGSLSDEEFKPLRLQNGWYIQRHAPMLRVAIPY
GALASQQLRALADIAEEYDRGYGHFTTRQNLQYNWIALADSADVMDRLAAVDMHGIQTSG
NCVRNISSDVFAGIAPDEIVDPRPFCEILRQWSTLHPEFAYLPRKFKIAVSGAREDRVAA
GWYDIGLQALSDEHGQIGFRVQVGGGMGRTPMIGDVIRDFLPWQQLLVYVEAILRVYNSY
GRRDNIWKARIKMLVKAEGARFTAAVEREFADILQRDPGGDAHLIPLHELNRVATQFAPP
HGVRPDAPDATAALATAPAHEPAYLRWLQRNVHTHRVPGLRAATLSLKRAGQAPGDVTAQ
QMRAAADLAERYSLGELRVSHEQNLVLPWVSAAALHALWRDARKAGFATPNIGLLTDMIA
CPGGDFCSLANARSIPIAAAIIERYTDLDELFDIGDIDLNISGCINSCGHHHSGHIGILG
VDKDGAEWYQITVGGGDGSELGGAALPGKIIGPSFAAEEVPDVVEALIALYLRQRQPGEL
FVAFARRVGAQPFKAAADAVRRATATPEHPQAAAPQQSAPEGDAKTPGGRPASHERPQGQ
LADPPSMGVKKTWGGPAFS
Download sequence
Identical sequences A0A160STL2 D6CMF6
WP_013106990.1.17751 WP_013106990.1.2408 WP_013106990.1.37844 WP_013106990.1.92352 gi|410694894|ref|YP_003625516.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]