SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479194511|ref|YP_007824049.1| from butyrate-producing bacterium SS3/4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479194511|ref|YP_007824049.1|
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 4.68e-35
Family Ribosomal protein L6 0.0000415
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.22e-26
Family Ribosomal protein L6 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479194511|ref|YP_007824049.1|
Sequence length 180
Comment LSU ribosomal protein L6P [butyrate-producing bacterium SS3/4]
Sequence
MSRIGRMPVAIPAGVTVTIAENNNVTVKGPKGTLVRDLPVEMEIKEEDGHIVVTRPNDLK
KMKSLHGLTRTLIHNMIQGVTEGYEKKLEVNGVGYRAQKQGKKLTLSLGYSHPVEMEDPE
GIETVLDGQNIIIVKGISKEKVGQYAAEIREKRRPEPYKGKGIKYADEVIRRKVGKTGKK
Download sequence
Identical sequences A0A1C6GRJ9 A0A1Q6K5C5 D7GUT0
gi|479194511|ref|YP_007824049.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]