SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479194914|ref|YP_007824452.1| from butyrate-producing bacterium SS3/4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479194914|ref|YP_007824452.1|
Domain Number 1 Region: 8-88
Classification Level Classification E-value
Superfamily Cell division protein ZapA-like 0.000000000641
Family Cell division protein ZapA-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479194914|ref|YP_007824452.1|
Sequence length 110
Comment Cell division protein ZapA [butyrate-producing bacterium SS3/4]
Sequence
MDEKNYTEVLINGNVYTLGGAEDPEYLQKVAAYINEKIAVLKAQPGFTRQNKDYQEVMIY
LNLADDYFKTLQEAMMLRSQKDEMEKEIYSLKHELIGLQMKQESAEKKAE
Download sequence
Identical sequences A0A1C5UNT6 D7GVY3 R5G478
gi|479194914|ref|YP_007824452.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]