SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479192982|ref|YP_007822520.1| from butyrate-producing bacterium SS3/4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479192982|ref|YP_007822520.1|
Domain Number 1 Region: 15-223
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 8.38e-58
Family PP-loop ATPase 0.0000551
Further Details:      
 
Domain Number 2 Region: 401-511
Classification Level Classification E-value
Superfamily PheT/TilS domain 7.32e-23
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.031
Further Details:      
 
Weak hits

Sequence:  gi|479192982|ref|YP_007822520.1|
Domain Number - Region: 298-367
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00196
Family MesJ substrate recognition domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479192982|ref|YP_007822520.1|
Sequence length 541
Comment tRNA(Ile)-lysidine synthetase, N-terminal domain/tRNA(Ile)-lysidine synthetase, C-terminal domain [butyrate-producing bacterium SS3/4]
Sequence
MAGKTAVKTDVKAGRFRQKVLSFMKKNHMTDRGDSVLAAVSGGADSVCLLLLLHEMAAEL
GIKVFAFHMNHGIRGAEADRDERFVMELCERLNIPLTVAHEKVEEYAAERGLSGEEAGRI
LRYHHLGETAEKYQCAKIAVAHHEDDDAETVLLNLFRGSGLAGLSGIRPVRENIIRPLLC
VSRKEIEEYLNEQELSWCEDSTNKENDYTRNKIRNELLPWVTENINSRAAEHILAVSEFA
AQADAYFEMEAERILEESCSKRREEGKQPNSKNAGEADGKEPGTGQSSKVAENEMKMCTK
INTDIFDPQPEILKTYIVRRMILNAAGKAKDITERHIRSVMDLSGPGGGHTVDLPYGLKA
VRGYETLGIVQNKNPSQMSESDQKQERKPVFENKINLETDMDEILDLGGTHIRLHAVHRK
KELEIPKNQYTKWFDYDKINVGLSIRYRKNGDYLTLSGGGKKKLRRYMIDEKIPENERDR
IPVLADGDHVLWVVGYRISDYYKITDETEHILEAEVILPGGGEPEGGRQAGIWNCKGEDH
G
Download sequence
Identical sequences D7GQF1
gi|479192982|ref|YP_007822520.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]