SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|399140297|ref|YP_006546398.1| from Melissococcus plutonius DAT561

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|399140297|ref|YP_006546398.1|
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.88e-29
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|399140297|ref|YP_006546398.1|
Sequence length 107
Comment phosphotransferase system PTS protein [Melissococcus plutonius DAT561]
Sequence
MNKEEVQLLGFEIVAYSGDARSELLTLLNETRQGNFEHVNEHLKNVDENLKLAHNSQTQT
LADEAAGKNMEMGFIFIHGQDHLMTTLLFRDLIQDFIELYREKYQKN
Download sequence
Identical sequences H5T6V2
gi|399140297|ref|YP_006546398.1| gi|399140297|ref|YP_006546398.1|NC_018265 WP_014868579.1.26313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]