SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389843667|ref|YP_006345747.1| from Mesotoga prima MesG1.Ag.4.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|389843667|ref|YP_006345747.1|
Domain Number - Region: 161-343
Classification Level Classification E-value
Superfamily ARM repeat 0.0426
Family Armadillo repeat 0.067
Further Details:      
 
Domain Number - Region: 65-145
Classification Level Classification E-value
Superfamily AF1862-like 0.0942
Family Cas Cmr5-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389843667|ref|YP_006345747.1|
Sequence length 479
Comment permease [Mesotoga prima MesG1.Ag.4.2]
Sequence
MSREILKKPRFNAAIFTLFYLALFFMVFSVSLQTAMIFFATFTVVIILEPWARFAERSFR
IKRSISLGIGLAVIFSGLTLLIVFLTTPVAKEASKFYNIVRDFFPSAEETEITSFEVNAN
IDTFLSEEEFLSKLSPEEVESLDLLSKDLKRYYSDIMDPITADSEDLNEDLALLEETLKN
RSDYVVIISSSKQKNASYEEIHKIISNYLNPEAAELLSASVLDNAMVVHSQELWRNVVDY
FMPKNIDPSTQRATYESVRNFLIQVQSSLMKFLPGILEKIPSFLTSTGLVLFFTIVGAIY
LSYYFLTVKDFIPRFYPKKVRGIAISFLEDTYKNLERYVISVVVIALIVGVVVGIVVHSM
GLKYSLLMGTWAAFTNLIPIVGVPLEFIPLFLLAVSTQDLVLVITLMIILVIVHASAFIL
FLVFMKGYNRINPVIIILMIVIAGQLWGLFGAIIAVPFAIVLKMTWMHFFSPMLEEEEQ
Download sequence
Identical sequences I2F3K1
gi|389843667|ref|YP_006345747.1| WP_014730557.1.93602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]