SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383318501|ref|YP_005379342.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383318501|ref|YP_005379342.1|
Domain Number 1 Region: 97-281
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.4e-62
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000837
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 4.91e-40
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00031
Further Details:      
 
Domain Number 3 Region: 318-447
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 3.92e-39
Family SerA intervening domain-like 0.0013
Further Details:      
 
Domain Number 4 Region: 443-523
Classification Level Classification E-value
Superfamily ACT-like 6.25e-17
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383318501|ref|YP_005379342.1|
Sequence length 526
Comment D-3-phosphoglycerate dehydrogenase [Methanocella conradii HZ254]
Sequence
MKVLITDPISDEGIKILKAEPGVQVDVETKLTKEQLIEKIKDYDALIIRSETQVTKEVID
AAQHLKIIGRAGVGIDNVDVPAATEKGIIVANAPEGNTIAACEHTLAMMFAMSRNIPQAN
ASLKGGKWERSKFMGVEVMGKTLGVIGLGRIGGEVTKRARCMGMEVLAYDPFTTPERAKD
LGARLTTLDEIYEKADYITVHTPLIPSTRHMISTPQFEKMKKGVRIINCARGGIIDEAAL
LEALKSGKVAGAALDVFEKEPPVGSPLLELPNVIVTPHLGASTKEAQISVATIIAEQVIN
AFKGLPVTTALNIPVMKPEAMEKIKPYLPLAESLGKFAAQVVDGRIKEIDVTYSGEITQK
DVSLVTIAVVKGMLDVKKGELVNYVNAKAVAKEYGINIVESKSGEVGDYTNLITVTVKTD
SMQRRVQGTIFGNKDARIVGIDGYRIEAIPAGYMIVTMHKDRPGVIGNVGTVLGKNDINI
AGMTVGREAVRGEAIMILNVDDAVPQPVLKEMIEKAGLYDAYYVKL
Download sequence
Identical sequences H8I5C9
gi|383318501|ref|YP_005379342.1| WP_014404662.1.51978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]