SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383318958|ref|YP_005379799.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383318958|ref|YP_005379799.1|
Domain Number 1 Region: 165-263
Classification Level Classification E-value
Superfamily DNA primase core 0.00000000105
Family DNA primase DnaG catalytic core 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383318958|ref|YP_005379799.1|
Sequence length 442
Comment DNA primase (bacterial type) [Methanocella conradii HZ254]
Sequence
MEESDTTKYVIHAHISAEGVVERPDVVGAVFGQTEGLLGADLDLRELQKTGRIGRIEVNI
TSKYGKSSGNILIPSSLDKVETSILAAALETIDRVGPCISKISVTKIEDVRSSKRQQIIE
RAKHILTAMFDETVPESQELTEAVKSAVRVEEVTFIDNLPAGPDVLDSDAIIVVEGRADV
LNLLRAGIKNAIAVEGTNVPQLVAELSKKKTVTVFTDSDRGGDLILKELLQVADVDYIAR
PPEGKSVEDLTQKEIIKALRSKVPVEQVVEVPQRRRNKQQQQQQEAARAEQNGKHDAQQR
EYQRPERPERERGETPRRKSLRRMEERPERREPPKEQEQQPEAKKPEPREAGEFAEIMKD
LAGTLSAKLLDANKNVLQKVAVRDLANVLKETNGEVKSVVFDGVITQRMLDIAAEKNLEY
LVGVKMGSIVKQPANVKVITTE
Download sequence
Identical sequences H8I583
WP_014405119.1.51978 gi|383318958|ref|YP_005379799.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]