SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383318969|ref|YP_005379810.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383318969|ref|YP_005379810.1|
Domain Number 1 Region: 11-465
Classification Level Classification E-value
Superfamily L-aspartase-like 1.54e-120
Family L-aspartase/fumarase 0.000000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383318969|ref|YP_005379810.1|
Sequence length 500
Comment argininosuccinate lyase [Methanocella conradii HZ254]
Sequence
MDNKEDILRRGRLSAAKSEEINAFTSSLQADRWIFPSDIMVDKAHTAMLAKQGVIEKKDA
ASILKAIGEIEAEGVDSVHIEQFEDVHMAIESRLIKRVGEGVGGRMHSGRSRNDEVATCI
RISARNELLGLMTDLLELRSAIVRLAEDNVDTVMPGFTHLQHAQPTTLAHHLMAHASAMD
RDFERLLDAYKYVNLNPLGSAAFASTGFPLDREYTTRLLGFDRPMDNSMDGVSSRDFILT
TLSAIAILETDLSRLADELVLWSTPEFGFVELDDAYASTSSIMPQKKNPDVLELVRGRCG
TVIGHMVSAFTIVKGLPYSYNSDLQEVTPQLLRSFEISRSSTRILAGAVSTLKVNRDEMA
RKSTMGFTTATEIADTIVRATGLPFRTAHGIVGRLARGGGDPSLDDVDEASMAMIGRKLS
DMGLTEEMLEEAKDPMKNVERRKILGGPAKSAIRKKLAAENARLKADEKALAALREKLDE
ASGELSRIVDEIVLEAHHGL
Download sequence
Identical sequences H8I594
gi|383318969|ref|YP_005379810.1| WP_014405130.1.51978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]