SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383319079|ref|YP_005379920.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383319079|ref|YP_005379920.1|
Domain Number 1 Region: 1-231
Classification Level Classification E-value
Superfamily NIF3 (NGG1p interacting factor 3)-like 4.71e-52
Family NIF3 (NGG1p interacting factor 3)-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383319079|ref|YP_005379920.1|
Sequence length 253
Comment dinuclear metal center protein [Methanocella conradii HZ254]
Sequence
MKVESLISRLEEIAPPGLAEEYDAGRIGLILKGSREVGRVAVALDPTPYAIRRAAEDGAG
MLVTHHTLIWDPVSRISEELAHKLRLLLDNGLSLYTMHTNYDNAPGGVNDVLAGLIGLRS
PEAFYGGRVGTVEEMSLRELACMASARLGCSVEYVGEESRMVRHVATVAGSGFRLALEHA
KENRIDVVLSSELKHDVIRGRGEVALVSAPHYYTEAPAMRSLAERLNAIVPTVFIDDPPR
IKTIKWDEIRERV
Download sequence
Identical sequences H8I6T1
WP_014405240.1.51978 gi|383319079|ref|YP_005379920.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]