SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383319588|ref|YP_005380429.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383319588|ref|YP_005380429.1|
Domain Number 1 Region: 162-353
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 2.36e-67
Family Actin/HSP70 0.00000094
Further Details:      
 
Domain Number 2 Region: 355-511
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 5.49e-62
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.00000176
Further Details:      
 
Domain Number 3 Region: 2-159
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.3e-56
Family Actin/HSP70 0.00000603
Further Details:      
 
Domain Number 4 Region: 478-577
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00000000000107
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|383319588|ref|YP_005380429.1|
Sequence length 617
Comment chaperone protein DnaK [Methanocella conradii HZ254]
Sequence
MTKIIGIDLGTSNSEAAVLEGGKPVIIPSAEGARMFPSVVAFTKSGERLVGEAARRQAVT
NPERTIMAIKRKMGTDYKVDIDGKKYTPQEISAMILSKIKQDAEAFLGEKITKAVITVPA
YFNDNQRQATKDAGTIAGLEVLRVINEPTAAALAYGLDKKGSQKILVFDLGGGTLDVTIM
EMGDGVFEVLSTSGDTQLGGTDMDNRIIDYIANTFQKEHGIDLRKDKMAMQRLRDAAEKA
KIELSSTLQTNINLPFITADQNGPKHLDMTLTRAKLEELVRDVVDRCYAPMRQAISDAKL
TASQIDHIILVGGPTRMPIIQEMVRKFFGKDPERGIDPMECVAMGAAIQGGVLAGEVKDL
LLLDVTPLSLGIETLGGVFTKLIERNTTIPTRRSQVFSTAADNQTSVEIHVLQGERPMAA
DNTTLGRFHLIGIPPAPRGIPQIEVTFDIDANGILNVKAKDLGTGKEQAITITASTKLSK
EQIDRMMKEAERFAAEDARKKEKAEVLNNADAILYAAQKTISEAGDKITADQKDRINKGI
ESLKEAQKSEDIARIKAETENLTKAVNEVATIMYQQAAQAYQQQQQAQQQKEKAQADGGK
GSNVVDAEFEVKDDKKN
Download sequence
Identical sequences H8I7S5
WP_014405748.1.51978 gi|383319588|ref|YP_005380429.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]