SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|383320727|ref|YP_005381568.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383320727|ref|YP_005381568.1|
Domain Number 1 Region: 312-420
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000161
Family Heme-binding PAS domain 0.065
Further Details:      
 
Domain Number 2 Region: 178-259
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000192
Family Heme-binding PAS domain 0.015
Further Details:      
 
Domain Number 3 Region: 14-68
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000316
Family Transcriptional regulator IclR, N-terminal domain 0.074
Further Details:      
 
Domain Number 4 Region: 71-180
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000558
Family Heme-binding PAS domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383320727|ref|YP_005381568.1|
Sequence length 457
Comment PAS fold-containing protein [Methanocella conradii HZ254]
Sequence
MEEYAAKLLLIKEFLQNKSPLRMSISAISRELGMRRSSVSKYLDMLQLTGDVTMVRYGKA
KLYTISQRVPYNALIDISPNDIIILDAKGRVEMVNKKFALDFDIDNVNKVIGSNICDLKL
KVFSDPAIQKNIRRLINGSLYIKEMEYIEEKTNRVYYLKFLPTVSNQGSQHIMVNVEDIT
SQVLKDEAFNILDKRLRTIFDEVPSGILFFRADGTILNANPASLRLFGIKKIQDMLNINL
FDFICAKDKIMSLIKEGKVNDIYISCDFDVLKNVKKIPTIKSGVSYFNIVFTPITTKDRE
NHLKEYAIMFKDVTAEKMVEKELRFKESRYRSFFDNTCNGMLIYQPVDNGEDYIIKDINK
ATEAILRIKKQDIIGKKIFTVFPDLLGFKVRELLKRVNLTEKPEVVPPLQYVVGEDQPWC
SHYVFKLPSGEIASFMIDVSDEMKAEDISKAKVCKLL
Download sequence
Identical sequences H8I4V6
gi|383320727|ref|YP_005381568.1| WP_014406881.1.51978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]