SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383320763|ref|YP_005381604.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383320763|ref|YP_005381604.1|
Domain Number 1 Region: 5-131
Classification Level Classification E-value
Superfamily Transposase IS200-like 6.15e-42
Family Transposase IS200-like 0.0000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383320763|ref|YP_005381604.1|
Sequence length 133
Comment transposase [Methanocella conradii HZ254]
Sequence
MVSNRWTHGNTTVYNIGYHLVWCSKYRRKVLVGNVEKRLKELLAKKADEIGVSIESIEVL
PDHLRLFVKAPPSAAPHWIVQQMKGYSSHELRKEFPDLKSRLPTLWTRSYYVESCGHISE
DTIKKYIAEQKNK
Download sequence
Identical sequences H8I4Z2
WP_014406917.1.51978 gi|383320763|ref|YP_005381604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]