SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383320861|ref|YP_005381702.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383320861|ref|YP_005381702.1|
Domain Number 1 Region: 116-242
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.52e-27
Family MJ1460-like 0.027
Further Details:      
 
Domain Number 2 Region: 19-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000309
Family TrmB-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383320861|ref|YP_005381702.1|
Sequence length 245
Comment transcriptional regulator (contains V4R domain), ArsR family [Methanocella conradii HZ254]
Sequence
MRGQVEIYSTKKGMIAIESPIKNKILQKLSERELTFEELIEVCEKARSTMSVHLNDLLSM
GLVYKRVDARDRRKKYFGLNTDLLVSSKVPVATHYEKILQSIPGTVGDKYGFLKSLFHLV
RSGMESYGVDTSPAMKKIGRDVGKTLAPFFKARTADALLKEVSEFWEAQGLGKVMILKSD
VPTIIVDDCFDCSTMPNIGRTQCSLDEGILEAIIEEKLKVKCSVEETECYGTGFHHCKFI
IKIFK
Download sequence
Identical sequences H8I7H4
WP_014407015.1.51978 gi|383320861|ref|YP_005381702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]