SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383320898|ref|YP_005381739.1| from Methanocella conradii HZ254

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383320898|ref|YP_005381739.1|
Domain Number 1 Region: 128-397
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.6e-105
Family BC ATP-binding domain-like 0.000000147
Further Details:      
 
Domain Number 2 Region: 667-927
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.47e-104
Family BC ATP-binding domain-like 0.000000228
Further Details:      
 
Domain Number 3 Region: 392-541
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 4.05e-48
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000814
Further Details:      
 
Domain Number 4 Region: 1-126
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.21e-47
Family BC N-terminal domain-like 0.00000599
Further Details:      
 
Domain Number 5 Region: 544-669
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.17e-44
Family BC N-terminal domain-like 0.0000115
Further Details:      
 
Domain Number 6 Region: 931-1064
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 6.8e-37
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383320898|ref|YP_005381739.1|
Sequence length 1086
Comment carbamoyl-phosphate synthase large subunit [Methanocella conradii HZ254]
Sequence
MPKRPDIKKVLLIGSGPILIGQAAEFDFSGSQACRSLREEGIEVVLVNSNPATIMTDPEM
ADAVYIEPLTPDVVAQIIERERPDGILAGLGGQTGLNITSELAEMGVLDKYGVKILGTPL
KAIYDTEDRDRFKHAMEAIGEKVPRSYACHSVEEAVAVVDKLGLPLIVRSAFTLGGTGSG
VAHTVQELKHIVELGLKRSRIHQVLVEESVLGWKEFEYEVMRDANDTCITICNMENIDPM
GIHTGESIVVTPSQTLSDEDHQTLRSAAIKIIRSLGIEGGCNIQFAWKDGDYRVVEVNPR
VSRSSALASKATGYPIARIAAKIAIGLNLHEIQNKVTMETPASFEPTIDYVVVKIPRWPF
DKFKNADKHITTSMKSTGEVMAIGRTFEEALQKAVNSLDISEFWGYGNWSKAEMADLLKN
PTHERLFVIYKALQTGAFTIEQIARLTNIDPWFIRKIKNIVDMAETLKADIGKETLLKAK
RMGFTDEWIAELHGITPEEVSDLRHRYGILPTFKMVDTCAAEFAAKTPYYYSTYEQECEL
VPSNRKKVLIIGAGPIRIGQGIEFDYCTVHAVNALRESGIEAHIINNNPETVSTDFDVSD
KLFFEPITLEHVMNVIEKERPYGVMVQFGGQTSVNMAIPLQMELNRRKDLGTIIIGTSPD
DMNIAEDRDLWGRMMKEMGILQPEHGIAYSTEEAKVEARRIGYPILVRPSYVLGGRAMEI
VYDEADLERYMAEAVKVSRKHPVLIDDFLENAIEIDVDAVSDGKDVLIGAIMEHIEEAGI
HSGDSACVIPPQSLPQEVQDRVREIVKKIALALHVKGCINIQMAYKDGKVYVLEANPRSS
RTIPFVSKATGVPLAKIAAKAIIGYTLKDMGYTEEPKPKYVSVKEVVLPFDKLPGADPLL
GPEMRSTGEVMGIDTDFGKAFFKAEQSAFNTLPTQGTVFISVRDEDKEEMARIARKLQSN
GLKLIGTSGTKKYLEARGIPVTLISKVHEGSPNVIDLMRKGKVDLIINTPTSKMARKDGS
RIRRAAVDFEVPYVTTIQAARASADAISAMGKSRMSIKSLNEYLEIKREGCAAGSVKVKH
PIKADP
Download sequence
Identical sequences H8I7L1
gi|383320898|ref|YP_005381739.1| WP_014407052.1.51978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]