SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479212591|ref|YP_007840373.1| from Eubacterium siraeum V10Sc8a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479212591|ref|YP_007840373.1|
Domain Number 1 Region: 201-311
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.01e-19
Family N-acetyl transferase, NAT 0.0082
Further Details:      
 
Domain Number 2 Region: 52-162
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000000631
Family N-acetyl transferase, NAT 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479212591|ref|YP_007840373.1|
Sequence length 325
Comment Acetyltransferases [Eubacterium siraeum V10Sc8a]
Sequence
MNKLNFIKADKPDCSNTTDSGKITVIVREFITTTLAEKIATALWNKPELADSIIRFNYDN
KIKNDCFNVIALNETGDVVGRLFCIQNAEDAGLWYYGDLFVVPDYTGKRISKRLLETAEQ
ALSDKWCHTLRCYVEPDNKESLRLQREYGFTECEYKTFNNLINSGQLMFEKPIVTFNAVA
VTEKNGARYITDIFNENAHLLHSEIIPYSEWCSLISANDTDEKHFLIRKGAVPCGYLKIN
GLEDGNDGWISILAVSSAFQRKGIGKYAVSYAESFLKKQGKLCVKIHTTTDNYPARKLYE
KCGYLLCNSTNTYTAKDKLTYFKQI
Download sequence
Identical sequences D4MM61
gi|479212591|ref|YP_007840373.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]