SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340623642|ref|YP_004742095.1| from Methanococcus maripaludis X1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340623642|ref|YP_004742095.1|
Domain Number 1 Region: 65-114
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000768
Family Psq domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340623642|ref|YP_004742095.1|
Sequence length 173
Comment hypothetical protein GYY_02345 [Methanococcus maripaludis X1]
Sequence
MSEKYKTYHTSKYLSKEDVENLIKEGVDEVTMPKSIYEYMEKKNKGALNRLLIFGVDVSI
TDQVGRPKKVEGDIKKKIIEEIINGKSIRKVAEEYDLKKSTIWDNIKDDMAKIKQEKFRK
MIYDYKELLIEKERYTEYIETLFCELDMNISNDNLKEAEKILLKIIEYSKRKD
Download sequence
Identical sequences G0H383 Q6M019
gi|340623642|ref|YP_004742095.1| 267377.MMP0454 369287 gi|45358017|ref|NP_987574.1| WP_011170398.1.40991 WP_011170398.1.41672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]