SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340623925|ref|YP_004742378.1| from Methanococcus maripaludis X1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340623925|ref|YP_004742378.1|
Domain Number 1 Region: 9-242
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.92e-75
Family SAICAR synthase 0.00000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340623925|ref|YP_004742378.1|
Sequence length 246
Comment phosphoribosylaminoimidazole-succinocarboxamide synthase [Methanococcus maripaludis X1]
Sequence
MSEYDISKILANEPIYAGKAKSIYKIEENEKEVLVEFRDDITAGNGAKHDVKSGKGYLNT
LISTELFNVLEKNNVPTHLIEYIEPNIMIAKNVKIIPLEVIVRNIAAGSLCKKYPFEQGQ
VLKTAVTQYDYKNDDYGDPMLNNEIAIELGLATEEELVEIKKLALKVNDVLKGFFDEKGI
MLVDFKIEVGKTVDGQIVVADEISPDTMRLWDKETKDVLDKDVFRKDLGDVLEKYKIVAE
RIGCLK
Download sequence
Identical sequences G0H4K4
WP_013999102.1.41672 gi|340623925|ref|YP_004742378.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]