SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340624027|ref|YP_004742480.1| from Methanococcus maripaludis X1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340624027|ref|YP_004742480.1|
Domain Number 1 Region: 1-136
Classification Level Classification E-value
Superfamily Resolvase-like 2.09e-44
Family gamma,delta resolvase, catalytic domain 0.0000973
Further Details:      
 
Weak hits

Sequence:  gi|340624027|ref|YP_004742480.1|
Domain Number - Region: 139-186
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000172
Family Cgl2762-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340624027|ref|YP_004742480.1|
Sequence length 193
Comment resolvase domain-containing protein [Methanococcus maripaludis X1]
Sequence
MIIGYARVSTKDQKLERQIDELRKAGCEKIFLEKISGTKKNRPEFDRMFGVLRSGDIILV
TELTRISRSTKDLVEIVESCKSLGVEIKSLKESWLDTTSAHGKLLFTIFAGLAEFERDLI
SERVKSGLNAARSRGRLGGRPQIDSEKVEMALKMYDSKEYTIKQILNATGISKFTLYNYL
DKRECKNRNKLDF
Download sequence
Identical sequences G0H4V6
gi|340624027|ref|YP_004742480.1| WP_013999199.1.41672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]