SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340624246|ref|YP_004742699.1| from Methanococcus maripaludis X1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340624246|ref|YP_004742699.1|
Domain Number 1 Region: 1-214
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.94e-65
Family Phosphate binding protein-like 0.0000298
Further Details:      
 
Domain Number 2 Region: 216-287
Classification Level Classification E-value
Superfamily GlnB-like 1.45e-19
Family ATP phosphoribosyltransferase (ATP-PRTase, HisG), regulatory C-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340624246|ref|YP_004742699.1|
Sequence length 288
Comment ATP phosphoribosyltransferase [Methanococcus maripaludis X1]
Sequence
MILLALPNKGRISKPVNEILEKSGLKISVHGRSLFAKTVDPEIKVMFARAKDIPEFVRDG
VADVGVTGYDLMLERDTEEELEMLLDFKFGNARLVLAAPENSDVNSIEDVKNGMKIATEF
PGLTKRYLEKKGLNLEIIELSGATEIAPFIGVSDLICDLTSTGTTLQLNRLKEIENVVSS
STRLVANKKSMEDPEKSAKINQVLSGIKSVMYAQSKRLIMMNAPKDKVSEITSVIPGMGG
PTVSEILSNCNMLAINAVIDENKVFETVSNLEKLGARDILVVPIERIL
Download sequence
Identical sequences G0H075 P60807
gi|340624246|ref|YP_004742699.1| 267377.MMP0947 WP_011170891.1.40991 WP_011170891.1.41672 gi|45358510|ref|NP_988067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]